F123019

General Info

Members Datasets Scaffolds Average Seq Length
124 79 248 473

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10001049|Ga0265324_100010497
Length 487
Sequence VVWRRTDFWTQHETQTRMSIKFGTSGWRDIIAHDFTFDNVRLATQGITDYLTSIAKDHKSKVVILGHDTRFLGREFSLAAAEVLAANGFEPLLCDRDTPTPVISHTIRYRKALGGINMTASHNPAEYQGLKFSTFNGAPATPDVTEQIEAAIAQRKAQGWTFKGAVIGTYQCKTFNPRPDYFKQIGRFVDFGVLKKAKMKIAVDLSYGTGHGYLDSLLEGVGAKVTLFHNERDPLFGGHHPEPNAEGMADAAKFVRSGKAQMGLGLDGDADRFGIVDRDGTWLTPNQILALTLYHLKKNRGWTGAVVRTVPTSHQVDAVAKMLGVKVYETPVGFKYIGALMESEPIIVGGEESGGLSVKGHVPEKDGILACLLMAELVATEKKSLGQILKELSKKIGEFYTDRINVAIAPDKKEALLARLAKGLDHVGPFKVEKFITTDGYKFLLPNGEWVAFRASGTEPLIRCYLEAKSKANLKKLDAACRKLLAA

Samples

Sample ID Description Type Environment
1 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
35 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
36 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
37 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
38 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
39 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
40 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
43 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
44 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
45 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
46 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
50 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
59 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
60 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
61 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
62 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
63 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
64 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
65 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
66 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
67 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
68 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
69 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
70 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
71 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
72 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
73 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
74 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
75 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
76 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
79 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 99.19
Stem 0
Stem Tuber 0
Unclassified 8.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265324_10001049 3300029957 Bacteria 16838
2 Ga0070683_100029371 3300005329 Bacteria 4977
3 Ga0070690_100008253 3300005330 Bacteria 5991
4 Ga0070689_100008336 3300005340 Bacteria 7296
5 Ga0070689_100092724 3300005340 Bacteria 2383
6 Ga0070689_100122123 3300005340 Bacteria 2081
7 Ga0070688_100029738 3300005365 Bacteria 3274
8 Ga0070688_100105379 3300005365 Unclassified 1866
9 Ga0070711_100041850 3300005439 Bacteria 3095
10 Ga0070708_100060778 3300005445 Bacteria 3373
11 Ga0070684_100030662 3300005535 Bacteria 4571
12 Ga0070686_100002078 3300005544 Bacteria 11058
13 Ga0068855_100277525 3300005563 Bacteria 1862
14 Ga0068857_100014722 3300005577 Bacteria 6825
15 Ga0068859_100005882 3300005617 Bacteria 12448
16 Ga0068863_100008449 3300005841 Bacteria 10058
17 Ga0068858_100028230 3300005842 Bacteria 5214
18 Ga0097621_100006140 3300006237 Bacteria 8509
19 Ga0068871_100124251 3300006358 Bacteria 2183
20 Ga0075431_100008923 3300006847 Bacteria 10048
21 Ga0097620_100005882 3300006931 Bacteria 12448
22 Ga0105240_10002478 3300009093 Bacteria 29672
23 Ga0105240_10033901 3300009093 Bacteria 6592
24 Ga0105240_10060122 3300009093 Bacteria 4738
25 Ga0111539_10075759 3300009094 Bacteria 3963
26 Ga0111539_10191378 3300009094 Bacteria 2387
27 Ga0105245_10231639 3300009098 Bacteria 1787
28 Ga0105242_10063682 3300009176 Bacteria 3037
29 Ga0105238_10011817 3300009551 Bacteria 8796
30 Ga0105238_10093114 3300009551 Unclassified 3001
31 Ga0157370_10033714 3300013104 Bacteria 4991
32 Ga0157374_10239840 3300013296 Unclassified 1783
33 Ga0157375_10000062 3300013308 Bacteria 113405
34 Ga0157375_10029802 3300013308 Bacteria 5136
35 Ga0163163_10000097 3300014325 Bacteria 92228
36 Ga0207695_10127959 3300025913 Unclassified 2500
37 Ga0207662_10079331 3300025918 Bacteria 2000
38 Ga0207670_10000661 3300025936 Bacteria 18269
39 Ga0207702_10028148 3300026078 Bacteria 4669
40 Ga0207641_10008345 3300026088 Bacteria 8563
41 Ga0207674_10009573 3300026116 Bacteria 11053
42 Ga0207428_10149060 3300027907 Bacteria 1781
43 Ga0265337_1001895 3300028556 Bacteria 9951
44 Ga0265337_1003198 3300028556 Bacteria 7187
45 Ga0265337_1019068 3300028556 Bacteria 2169
46 Ga0265326_10029895 3300028558 Bacteria 1552
47 Ga0265319_1000013 3300028563 Bacteria 180699
48 Ga0265334_10004609 3300028573 Bacteria 6095
49 Ga0265334_10031266 3300028573 Bacteria 2128
50 Ga0265323_10000071 3300028653 Bacteria 56313
51 Ga0265322_10003426 3300028654 Bacteria 4794
52 Ga0265338_10000036 3300028800 Bacteria 238689
53 Ga0265338_10000439 3300028800 Bacteria 74770
54 Ga0265338_10001944 3300028800 Bacteria 32265
55 Ga0265338_10002649 3300028800 Bacteria 26353
56 Ga0265338_10004521 3300028800 Bacteria 18745
57 Ga0265338_10006747 3300028800 Bacteria 14490
58 Ga0265338_10011712 3300028800 Bacteria 10096
59 Ga0265338_10026171 3300028800 Bacteria 5894
60 Ga0265338_10031295 3300028800 Bacteria 5219
61 Ga0265338_10034985 3300028800 Bacteria 4840
62 Ga0265338_10039808 3300028800 Bacteria 4426
63 Ga0265338_10046006 3300028800 Bacteria 4005
64 Ga0265338_10047165 3300028800 Unclassified 3939
65 Ga0265338_10053637 3300028800 Bacteria 3604
66 Ga0265338_10086473 3300028800 Bacteria 2609
67 Ga0265338_10178946 3300028800 Bacteria 1619
68 Ga0265338_10179602 3300028800 Unclassified 1615
69 Ga0265324_10011376 3300029957 Bacteria 3391
70 Ga0265324_10020214 3300029957 Bacteria 2393
71 Ga0265325_10036412 3300031241 Bacteria 2606
72 Ga0265329_10003505 3300031242 Bacteria 6798
73 Ga0265340_10005932 3300031247 Bacteria 6753
74 Ga0265340_10025747 3300031247 Bacteria 2978
75 Ga0265339_10023117 3300031249 Bacteria 3596
76 Ga0265339_10026277 3300031249 Bacteria 3335
77 Ga0265339_10049159 3300031249 Bacteria 2311
78 Ga0265327_10001118 3300031251 Bacteria 37019
79 Ga0265316_10007166 3300031344 Bacteria 10537
80 Ga0265316_10023290 3300031344 Bacteria 5205
81 Ga0265316_10103447 3300031344 Bacteria 2162
82 Ga0265313_10001974 3300031595 Bacteria 18535
83 Ga0265314_10001100 3300031711 Bacteria 31213
84 Ga0265314_10021145 3300031711 Bacteria 5011
85 Ga0265342_10030735 3300031712 Bacteria 3325
86 Ga0307416_100168167 3300032002 Bacteria 2037
87 Ga0373947_0048629 3300035725 Unclassified 2545
88 Ga0395900_0034770 3300037418 Bacteria 5191
89 Ga0395905_0048653 3300037471 Bacteria 3973
90 Ga0451577_0016359 3300042876 Bacteria 6871
91 Ga0453684_0002872 3300044712 Bacteria 40404
92 Ga0453684_0010963 3300044712 Bacteria 15323
93 Ga0451576_0097643 3300045051 Bacteria 3055
94 Ga0451576_0125457 3300045051 Bacteria 2675
95 Ga0495592_0000231 3300046454 Bacteria 48322
96 Ga0495641_0014274 3300046461 Bacteria 4305
97 Ga0495582_0020572 3300046473 Bacteria 3613
98 Ga0495618_0063005 3300046514 Bacteria 2353
99 Ga0495618_0111892 3300046514 Unclassified 1748
100 Ga0495628_0000634 3300046516 Bacteria 32129
101 Ga0495630_0000024 3300046517 Bacteria 155139
102 Ga0495630_0103673 3300046517 Bacteria 2152
103 Ga0495666_0044948 3300046526 Unclassified 2131
104 Ga0495652_0144443 3300046529 Bacteria 1867
105 Ga0495640_0009365 3300046533 Bacteria 7626
106 Ga0495586_0000006 3300046535 Bacteria 168866
107 Ga0495586_0000978 3300046535 Bacteria 16176
108 Ga0495586_0036250 3300046535 Bacteria 2647
109 Ga0495634_0019384 3300046642 Bacteria 4835
110 Ga0495634_0096748 3300046642 Bacteria 1911
111 Ga0495658_0023132 3300046683 Bacteria 3296
112 Ga0495658_0048575 3300046683 Bacteria 2393
113 Ga0495613_0003490 3300046689 Bacteria 11765
114 Ga0495613_0048322 3300046689 Bacteria 3142
115 Ga0495604_0177516 3300047317 Bacteria 1492
116 Ga0495674_0004837 3300047319 Bacteria 12951
117 Ga0495674_0009850 3300047319 Bacteria 9072
118 Ga0495676_0047318 3300047321 Bacteria 3479
119 Ga0495680_0009922 3300047322 Bacteria 8532
120 Ga0495675_0063931 3300047444 Unclassified 2328
121 Ga0496115_0005011 3300048918 Bacteria 9620
122 Ga0501033_0055723 3300049570 Bacteria 2922
123 nmdc:mga08y16_49053_c1 3300050511 Bacteria 4418
124 Ga0590075_011632 3300059424 Unclassified 2130
125 Ga0265324_10001049
126 Ga0070683_100029371
127 Ga0070690_100008253
128 Ga0070689_100008336
129 Ga0070689_100092724
130 Ga0070689_100122123
131 Ga0070688_100029738
132 Ga0070688_100105379
133 Ga0070711_100041850
134 Ga0070708_100060778
135 Ga0070684_100030662
136 Ga0070686_100002078
137 Ga0068855_100277525
138 Ga0068857_100014722
139 Ga0068859_100005882
140 Ga0068863_100008449
141 Ga0068858_100028230
142 Ga0097621_100006140
143 Ga0068871_100124251
144 Ga0075431_100008923
145 Ga0097620_100005882
146 Ga0105240_10002478
147 Ga0105240_10033901
148 Ga0105240_10060122
149 Ga0111539_10075759
150 Ga0111539_10191378
151 Ga0105245_10231639
152 Ga0105242_10063682
153 Ga0105238_10011817
154 Ga0105238_10093114
155 Ga0157370_10033714
156 Ga0157374_10239840
157 Ga0157375_10000062
158 Ga0157375_10029802
159 Ga0163163_10000097
160 Ga0207695_10127959
161 Ga0207662_10079331
162 Ga0207670_10000661
163 Ga0207702_10028148
164 Ga0207641_10008345
165 Ga0207674_10009573
166 Ga0207428_10149060
167 Ga0265337_1001895
168 Ga0265337_1003198
169 Ga0265337_1019068
170 Ga0265326_10029895
171 Ga0265319_1000013
172 Ga0265334_10004609
173 Ga0265334_10031266
174 Ga0265323_10000071
175 Ga0265322_10003426
176 Ga0265338_10000036
177 Ga0265338_10000439
178 Ga0265338_10001944
179 Ga0265338_10002649
180 Ga0265338_10004521
181 Ga0265338_10006747
182 Ga0265338_10011712
183 Ga0265338_10026171
184 Ga0265338_10031295
185 Ga0265338_10034985
186 Ga0265338_10039808
187 Ga0265338_10046006
188 Ga0265338_10047165
189 Ga0265338_10053637
190 Ga0265338_10086473
191 Ga0265338_10178946
192 Ga0265338_10179602
193 Ga0265324_10011376
194 Ga0265324_10020214
195 Ga0265325_10036412
196 Ga0265329_10003505
197 Ga0265340_10005932
198 Ga0265340_10025747
199 Ga0265339_10023117
200 Ga0265339_10026277
201 Ga0265339_10049159
202 Ga0265327_10001118
203 Ga0265316_10007166
204 Ga0265316_10023290
205 Ga0265316_10103447
206 Ga0265313_10001974
207 Ga0265314_10001100
208 Ga0265314_10021145
209 Ga0265342_10030735
210 Ga0307416_100168167
211 Ga0373947_0048629
212 Ga0395900_0034770
213 Ga0395905_0048653
214 Ga0451577_0016359
215 Ga0453684_0002872
216 Ga0453684_0010963
217 Ga0451576_0097643
218 Ga0451576_0125457
219 Ga0495592_0000231
220 Ga0495641_0014274
221 Ga0495582_0020572
222 Ga0495618_0063005
223 Ga0495618_0111892
224 Ga0495628_0000634
225 Ga0495630_0000024
226 Ga0495630_0103673
227 Ga0495666_0044948
228 Ga0495652_0144443
229 Ga0495640_0009365
230 Ga0495586_0000006
231 Ga0495586_0000978
232 Ga0495586_0036250
233 Ga0495634_0019384
234 Ga0495634_0096748
235 Ga0495658_0023132
236 Ga0495658_0048575
237 Ga0495613_0003490
238 Ga0495613_0048322
239 Ga0495604_0177516
240 Ga0495674_0004837
241 Ga0495674_0009850
242 Ga0495676_0047318
243 Ga0495680_0009922
244 Ga0495675_0063931
245 Ga0496115_0005011
246 Ga0501033_0055723
247 nmdc:mga08y16_49053_c1
248 Ga0590075_011632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02879

PGM_PMM_II

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II

179

280

0.98

PF02880

PGM_PMM_III

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III

284

396

0.96

PF02878

PGM_PMM_I

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I

19

159

0.95

PF00408

PGM_PMM_IV

Phosphoglucomutase/phosphomannomutase, C-terminal domain

404

484

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tuo-assembly1.cif.gz_A crystal structure of putative phosphomannomutase from thermus thermophilus hb8 0.8887 3 469
2fkm-assembly1.cif.gz_X pmm/pgm s108d mutant with alpha-d-glucose 1,6-bisphosphate bound 0.8834 20 467
1tuo-assembly1.cif.gz_A crystal structure of putative phosphomannomutase from thermus thermophilus hb8 0.881 3 469
3rsm-assembly1.cif.gz_A crystal structure of s108c mutant of pmm/pgm 0.8741 20 467
4il8-assembly1.cif.gz_A crystal structure of an h329a mutant of p. aeruginosa pmm/pgm 0.8738 23 467
ID Description Score Start End Superfamily
af_Q2FVC1_33_181_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9226 20 137 3.40.120.10
af_O74478_35_192_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9173 20 136 3.40.120.10
1tuoA03 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9168 263 378 3.40.120.10
af_Q8IJS0_30_224_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9075 20 136 3.40.120.10
af_A1Z9V3_60_223_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.8991 20 136 3.40.120.10
ID Description Score Start End GO Terms
AF-A0A353DZ95-F1-model_v4 Phosphoglucomutase 0.965 118 469 GO:0004614
GO:0005829
GO:0005975
AF-A0A7C8D8P6-F1-model_v4 deleted 0.9608 3 469
AF-A0A350I2A3-F1-model_v4 Phosphoglucomutase 0.9606 147 469 GO:0004614
GO:0005829
GO:0005975
AF-A0A350I2A3-F1-model_v4 Phosphoglucomutase 0.9577 147 469 GO:0004614
GO:0005829
GO:0005975
AF-A0A7C8D8P6-F1-model_v4 deleted 0.9548 3 469

Map