F122021

General Info

Members Datasets Scaffolds Average Seq Length
124 91 248 405

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10000678|Ga0075370_1000067819
Length 421
Sequence MAFGDSPHDAGLRSAWQQFCRQLEVAGDCAFKDTIPASGLHRVDALRFLTQNLGQAFDLALETRNTQYPVIHAFCGPFRKLGGDNADFTYQQAWIDGQSTYRISGNRGTARFFNIAVQGPRPTSRAEQPDWRPLHEPFGDTPEANLFGHDMEIGWDGSFEVYVGGEKPDPALCPNWLPTTPGTRKLFIRQGFDDWSELPVTMRIERIGMTEPRPMPDPAEMIAAIEWAGDFVTGVAGDWPDWPYTFAEDVDPAQVNRFPGARRASGDPVYNPELDKKRGRAPTTMCWRLAPDEALIIEWDRNDLFWMMTNMGMSFNSMDYLYRSVSHSPARVKVDSDGRIRMVLAHSDPGFHNWIDTCGFEQGEICNRNMLTDQATDFRTRVVKHDALSQEMPADSPRVTPDQRTRMMQERFHAIMRRYRL

Samples

Sample ID Description Type Environment
1 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
5 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
6 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
7 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
8 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
12 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
16 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
19 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
20 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
21 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
22 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
32 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
33 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
34 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
35 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
36 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
37 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
38 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
39 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
40 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
41 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
42 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
43 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
44 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
45 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
46 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
47 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
48 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
49 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
50 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
51 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
52 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
53 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
54 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
55 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
56 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
57 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
58 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
59 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
60 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
61 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
70 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
71 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
72 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
73 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
74 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
76 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
77 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
78 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
79 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
80 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
81 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
82 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
83 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
84 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
85 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
86 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
87 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
88 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
89 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
90 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
91 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 0
Isolates 3.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.74
Nodule 0.81
Rhizoplane 8.06
Rhizosphere 52.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075370_10000678 3300006353 Bacteria 13329
2 rootH2_10031473 3300003320 Bacteria 2381
3 Ga0068868_100006209 3300005338 Bacteria 8450
4 Ga0070700_100027454 3300005441 Bacteria 3375
5 Ga0070663_100082522 3300005455 Bacteria 2365
6 Ga0070685_10140888 3300005466 Bacteria 1518
7 Ga0068862_100137448 3300005844 Bacteria 2167
8 Ga0081539_10020717 3300005985 Bacteria 4428
9 Ga0081539_10023163 3300005985 Bacteria 4076
10 Ga0075365_10046532 3300006038 Bacteria 2850
11 Ga0075365_10131086 3300006038 Bacteria 1735
12 Ga0075363_100016706 3300006048 Bacteria 3629
13 Ga0075363_100022293 3300006048 Bacteria 3200
14 Ga0075364_10026949 3300006051 Bacteria 3669
15 Ga0075364_10042597 3300006051 Bacteria 2950
16 Ga0075364_10058619 3300006051 Bacteria 2523
17 Ga0075370_10013129 3300006353 Bacteria 4395
18 Ga0075430_100050167 3300006846 Bacteria 3521
19 Ga0075431_100229493 3300006847 Bacteria 1892
20 Ga0105245_10009523 3300009098 Bacteria 8470
21 Ga0105248_10018801 3300009177 Bacteria 7642
22 Ga0105239_10094491 3300010375 Bacteria 3302
23 Ga0157369_10099602 3300013105 Bacteria 3098
24 Ga0157375_10016128 3300013308 Bacteria 6701
25 Ga0157377_10045539 3300014745 Bacteria 2451
26 Ga0213876_10005031 3300021384 Bacteria 7291
27 Ga0213876_10010884 3300021384 Bacteria 4872
28 Ga0213876_10033111 3300021384 Bacteria 2724
29 Ga0213875_10001531 3300021388 Bacteria 14858
30 Ga0207688_10003548 3300025901 Bacteria 8511
31 Ga0207687_10011171 3300025927 Bacteria 5866
32 Ga0207704_10090919 3300025938 Bacteria 2005
33 Ga0207711_10051478 3300025941 Bacteria 3527
34 Ga0207689_10017643 3300025942 Bacteria 6033
35 Ga0207712_10056468 3300025961 Bacteria 2766
36 Ga0207677_10002200 3300026023 Bacteria 10244
37 Ga0207708_10044979 3300026075 Bacteria 3364
38 Ga0207676_10089552 3300026095 Bacteria 2522
39 Ga0265334_10000043 3300028573 Bacteria 94660
40 Ga0307509_10000034 3300031507 Bacteria 193380
41 Ga0307510_10000001 3300033180 Bacteria 1172244
42 Ga0436364_0428871 3300037853 Bacteria 3735
43 Ga0436364_1470150 3300037853 Bacteria 35135
44 Ga0436365_0064624 3300039437 Bacteria 2747
45 Ga0436365_0653800 3300039437 Bacteria 25450
46 Ga0436365_1563942 3300039437 Bacteria 128562
47 Ga0436363_0441453 3300039450 Bacteria 2230
48 Ga0466963_0103655 3300044694 Bacteria 1949
49 Ga0466971_0035147 3300044719 Bacteria 2247
50 Ga0466957_0094463 3300044842 Bacteria 1878
51 Ga0466967_0003168 3300045976 Bacteria 10609
52 Ga0466967_0005822 3300045976 Bacteria 8624
53 Ga0466967_0031461 3300045976 Bacteria 4467
54 Ga0466967_0043697 3300045976 Bacteria 3881
55 Ga0466967_0222095 3300045976 Bacteria 1796
56 Ga0495638_0041823 3300046460 Bacteria 2897
57 Ga0495596_0001399 3300046500 Bacteria 13856
58 Ga0495622_0063600 3300046557 Bacteria 1707
59 Ga0496100_0027951 3300048903 Bacteria 3474
60 Ga0496102_0054323 3300048905 Bacteria 3652
61 Ga0496102_0125624 3300048905 Bacteria 2397
62 Ga0496104_0025815 3300048907 Bacteria 5418
63 Ga0496105_0018044 3300048908 Bacteria 5664
64 Ga0496106_0007259 3300048909 Bacteria 8185
65 Ga0496107_0054675 3300048910 Bacteria 2882
66 Ga0496108_0001316 3300048911 Bacteria 19527
67 Ga0496109_0013983 3300048912 Bacteria 6979
68 Ga0496110_0142196 3300048913 Bacteria 2169
69 Ga0496116_0000311 3300048919 Bacteria 81431
70 Ga0496117_0091657 3300048920 Bacteria 1954
71 Ga0496118_0000029 3300048921 Bacteria 340978
72 Ga0496122_0000894 3300048925 Bacteria 55079
73 Ga0496123_0000895 3300048926 Bacteria 47152
74 Ga0496124_0002200 3300048927 Bacteria 26008
75 Ga0496125_0080496 3300048928 Bacteria 2492
76 Ga0496126_0000077 3300048929 Bacteria 231592
77 Ga0496126_0006577 3300048929 Bacteria 12948
78 Ga0496126_0162931 3300048929 Bacteria 1904
79 Ga0501032_0008484 3300049569 Bacteria 7492
80 Ga0501033_0033755 3300049570 Bacteria 3842
81 Ga0501033_0138514 3300049570 Bacteria 1760
82 Ga0501034_0070386 3300049571 Bacteria 3509
83 Ga0501037_0003875 3300049573 Bacteria 10851
84 Ga0501043_0013284 3300049579 Bacteria 6439
85 Ga0501046_0001160 3300049580 Bacteria 25618
86 Ga0501047_0004807 3300049581 Bacteria 12704
87 Ga0501047_0009099 3300049581 Bacteria 9378
88 Ga0501047_0075063 3300049581 Bacteria 3254
89 Ga0501048_0094417 3300049582 Bacteria 2110
90 Ga0501070_0002411 3300049586 Bacteria 16398
91 Ga0501070_0016309 3300049586 Bacteria 6240
92 Ga0501072_0010055 3300049588 Bacteria 7198
93 Ga0501074_0042806 3300049590 Bacteria 3276
94 Ga0501080_0091051 3300049742 Bacteria 2833
95 Ga0501080_0099687 3300049742 Bacteria 2695
96 Ga0501263_001442 3300049760 Bacteria 2240
97 Ga0501035_0000406 3300049822 Bacteria 48825
98 Ga0501035_0000810 3300049822 Bacteria 33350
99 Ga0501035_0050809 3300049822 Bacteria 3714
100 Ga0501044_0002833 3300049823 Bacteria 19735
101 Ga0501044_0003303 3300049823 Bacteria 18173
102 Ga0501044_0009184 3300049823 Bacteria 10799
103 nmdc:mga03683_61108_c1 3300050489 Bacteria 1592
104 nmdc:mga03n38_4555_c1 3300050490 Bacteria 4611
105 nmdc:mga03n38_4653_c1 3300050490 Bacteria 4576
106 nmdc:mga00v17_60052_c1 3300050491 Bacteria 2334
107 nmdc:mga00v17_69679_c1 3300050491 Bacteria 2177
108 nmdc:mga00v17_8098_c1 3300050491 Bacteria 5642
109 nmdc:mga0yw44_52209_c1 3300050492 Bacteria 2477
110 nmdc:mga07m45_10806_c1 3300050496 Bacteria 4781
111 nmdc:mga07m45_6615_c1 3300050496 Bacteria 5874
112 nmdc:mga0qj67_31565_c1 3300050509 Bacteria 4127
113 nmdc:mga0qj67_67644_c1 3300050509 Bacteria 2846
114 nmdc:mga0qj67_68563_c1 3300050509 Bacteria 2827
115 nmdc:mga06r32_142301_c1 3300050510 Bacteria 2375
116 Ga0500641_0045735 3300053096 Bacteria 1784
117 Ga0500652_000382 3300053131 Bacteria 15959
118 Ga0500622_0001655 3300053156 Bacteria 17421
119 Ga0500645_000007 3300053730 Bacteria 233700
120 Ga0466962_0017223 3300061719 Bacteria 3481
121 2644636993 2643221715 Bacteria 6671032
122 2842138550 2842134933 Bacteria 5847019
123 2902800099 2902799365 Bacteria 5419524
124 2902814864 2902810491 Bacteria 6794147
125 Ga0075370_10000678
126 rootH2_10031473
127 Ga0068868_100006209
128 Ga0070700_100027454
129 Ga0070663_100082522
130 Ga0070685_10140888
131 Ga0068862_100137448
132 Ga0081539_10020717
133 Ga0081539_10023163
134 Ga0075365_10046532
135 Ga0075365_10131086
136 Ga0075363_100016706
137 Ga0075363_100022293
138 Ga0075364_10026949
139 Ga0075364_10042597
140 Ga0075364_10058619
141 Ga0075370_10013129
142 Ga0075430_100050167
143 Ga0075431_100229493
144 Ga0105245_10009523
145 Ga0105248_10018801
146 Ga0105239_10094491
147 Ga0157369_10099602
148 Ga0157375_10016128
149 Ga0157377_10045539
150 Ga0213876_10005031
151 Ga0213876_10010884
152 Ga0213876_10033111
153 Ga0213875_10001531
154 Ga0207688_10003548
155 Ga0207687_10011171
156 Ga0207704_10090919
157 Ga0207711_10051478
158 Ga0207689_10017643
159 Ga0207712_10056468
160 Ga0207677_10002200
161 Ga0207708_10044979
162 Ga0207676_10089552
163 Ga0265334_10000043
164 Ga0307509_10000034
165 Ga0307510_10000001
166 Ga0436364_0428871
167 Ga0436364_1470150
168 Ga0436365_0064624
169 Ga0436365_0653800
170 Ga0436365_1563942
171 Ga0436363_0441453
172 Ga0466963_0103655
173 Ga0466971_0035147
174 Ga0466957_0094463
175 Ga0466967_0003168
176 Ga0466967_0005822
177 Ga0466967_0031461
178 Ga0466967_0043697
179 Ga0466967_0222095
180 Ga0495638_0041823
181 Ga0495596_0001399
182 Ga0495622_0063600
183 Ga0496100_0027951
184 Ga0496102_0054323
185 Ga0496102_0125624
186 Ga0496104_0025815
187 Ga0496105_0018044
188 Ga0496106_0007259
189 Ga0496107_0054675
190 Ga0496108_0001316
191 Ga0496109_0013983
192 Ga0496110_0142196
193 Ga0496116_0000311
194 Ga0496117_0091657
195 Ga0496118_0000029
196 Ga0496122_0000894
197 Ga0496123_0000895
198 Ga0496124_0002200
199 Ga0496125_0080496
200 Ga0496126_0000077
201 Ga0496126_0006577
202 Ga0496126_0162931
203 Ga0501032_0008484
204 Ga0501033_0033755
205 Ga0501033_0138514
206 Ga0501034_0070386
207 Ga0501037_0003875
208 Ga0501043_0013284
209 Ga0501046_0001160
210 Ga0501047_0004807
211 Ga0501047_0009099
212 Ga0501047_0075063
213 Ga0501048_0094417
214 Ga0501070_0002411
215 Ga0501070_0016309
216 Ga0501072_0010055
217 Ga0501074_0042806
218 Ga0501080_0091051
219 Ga0501080_0099687
220 Ga0501263_001442
221 Ga0501035_0000406
222 Ga0501035_0000810
223 Ga0501035_0050809
224 Ga0501044_0002833
225 Ga0501044_0003303
226 Ga0501044_0009184
227 nmdc:mga03683_61108_c1
228 nmdc:mga03n38_4555_c1
229 nmdc:mga03n38_4653_c1
230 nmdc:mga00v17_60052_c1
231 nmdc:mga00v17_69679_c1
232 nmdc:mga00v17_8098_c1
233 nmdc:mga0yw44_52209_c1
234 nmdc:mga07m45_10806_c1
235 nmdc:mga07m45_6615_c1
236 nmdc:mga0qj67_31565_c1
237 nmdc:mga0qj67_67644_c1
238 nmdc:mga0qj67_68563_c1
239 nmdc:mga06r32_142301_c1
240 Ga0500641_0045735
241 Ga0500652_000382
242 Ga0500622_0001655
243 Ga0500645_000007
244 Ga0466962_0017223
245 2644636993
246 2842138550
247 2902800099
248 2902814864

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06742

DUF1214

Protein of unknown function (DUF1214)

85

190

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ans-assembly2.cif.gz_B crystal structure of a putative uncharacterized protein from burkholderia cenocepacia 0.8472 6 371
6ans-assembly2.cif.gz_B crystal structure of a putative uncharacterized protein from burkholderia cenocepacia 0.8384 6 371
8u5f-assembly8.cif.gz_H crystal structure of trypsinized clostridium perfringens enterotoxin 0.5222 65 198
1olm-assembly2.cif.gz_C supernatant protein factor in complex with rrr-alpha-tocopherylquinone: a link between oxidized vitamin e and cholesterol biosynthesis 0.521 241 369
7qry-assembly2.cif.gz_B crystal structure of b30.2 pryspry domain of mid1 0.5094 241 363
ID Description Score Start End Superfamily
af_I6XHH2_45_177_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8342 59 203 3.40.47.10
af_I6XHH2_45_177_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8172 59 203 3.40.47.10
3vb9A04 Mainly Beta;Sandwich;Jelly Rolls;Domain of unknown function DUF1214, C-terminal domain 0.6033 82 195 2.60.120.600
1o6uC02 Mainly Beta;Sandwich;Jelly Rolls;GOLD domain 0.5651 241 362 2.60.120.680
3u07C02 Mainly Beta;Sandwich;Jelly Rolls; 0.5628 95 196 2.60.120.1600
ID Description Score Start End GO Terms
AF-A0A828TA03-F1-model_v4 deleted 0.9779 71 400
AF-A0A2W5NMQ6-F1-model_v4 DUF1214 domain-containing protein 0.9768 1 400
AF-A0A2W5NMQ6-F1-model_v4 DUF1214 domain-containing protein 0.9744 1 400
AF-A0A2S9FBQ2-F1-model_v4 DUF1214 domain-containing protein 0.9673 144 399
AF-A0A828TA03-F1-model_v4 deleted 0.9664 71 400

Map