F115680

General Info

Members Datasets Scaffolds Average Seq Length
122 54 122 220

Family's Representative Sequence

Representative Sequence 3300046535|Ga0495586_0000585|Ga0495586_0000585_15723_16481
Length 252
Sequence VSARKALVAARRSAEITSLGGKLDPSRPTVISLCDLTGHMVQPWVEAGYNAILIDPQHGTSRVEGRIAYVAGTIEDALGLIGDVMRAGRIAIIFGFPPCTDMAVSGARWFESKRAADAMFQAKAVMVAEQCRTAGRLSGAPWMVENPVSVLSSAFGKPQHTFHPADYTAYEPADNYTKKTCLWTGGGFIMPQPAKDGSLGAPDNRIHYASPGAERANFRSATPMGFARAVFEANTNRMIDAGRNAGELVGVA

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
3 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
4 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
5 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
6 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
7 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
8 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
9 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
10 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
11 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
12 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
13 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
16 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
17 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
18 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
19 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
20 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
21 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
22 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
23 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
24 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
25 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
26 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
27 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
28 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
29 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
30 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
31 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
32 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
33 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
34 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
35 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
36 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
37 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
38 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
39 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
40 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
41 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
42 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
43 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
44 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
45 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
46 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
47 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
48 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
49 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
50 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
51 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
52 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
53 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
54 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.46
Rhizosphere 97.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10002391 3300005288 Bacteria 38484
2 Ga0065714_10064712 3300005288 Viruses 22027
3 Ga0065714_10065953 3300005288 Bacteria 7975
4 Ga0065714_10070738 3300005288 Viruses 3778
5 Ga0065714_10083578 3300005288 Viruses 2242
6 Ga0065714_10112221 3300005288 Unclassified 1453
7 Ga0065714_10112449 3300005288 Unclassified 1455
8 Ga0065714_10136489 3300005288 Unclassified 1205
9 Ga0068852_100245746 3300005616 Bacteria 1712
10 Ga0105244_10001153 3300009036 Bacteria 21870
11 Ga0105244_10019141 3300009036 Bacteria 3830
12 Ga0105244_10112225 3300009036 Unclassified 1325
13 Ga0157373_10013774 3300013100 Bacteria 5928
14 Ga0157373_10037055 3300013100 Viruses 3499
15 Ga0157373_10047475 3300013100 Viruses 3063
16 Ga0157371_10006713 3300013102 Bacteria 9410
17 Ga0157371_10032978 3300013102 Viruses 3723
18 Ga0157371_10169299 3300013102 Viruses 1561
19 Ga0157371_10523626 3300013102 Viruses 877
20 Ga0157370_10047170 3300013104 Viruses 4130
21 Ga0157370_10064468 3300013104 Bacteria 3469
22 Ga0157370_10073541 3300013104 Viruses 3225
23 Ga0157370_10299936 3300013104 Bacteria 1483
24 Ga0157369_10005005 3300013105 Bacteria 15523
25 Ga0157369_10030288 3300013105 Bacteria 5970
26 Ga0157369_10063499 3300013105 Bacteria 3978
27 Ga0157369_10096185 3300013105 Viruses 3160
28 Ga0157369_10102645 3300013105 Bacteria 3047
29 Ga0157369_10127826 3300013105 Viruses 2693
30 Ga0157369_10591775 3300013105 Viruses 1145
31 Ga0157374_10288397 3300013296 Bacteria 1622
32 Ga0163162_10007783 3300013306 Bacteria 10446
33 Ga0163162_10039513 3300013306 Viruses 4715
34 Ga0163162_10090200 3300013306 Viruses 3146
35 Ga0163162_10361649 3300013306 Bacteria 1584
36 Ga0163162_10423634 3300013306 Viruses 1463
37 Ga0163162_10424964 3300013306 Viruses 1461
38 Ga0163162_10509380 3300013306 Unclassified 1334
39 Ga0163162_10552254 3300013306 Bacteria 1280
40 Ga0163162_10728339 3300013306 Viruses 1112
41 Ga0157372_10005941 3300013307 Bacteria 12977
42 Ga0157375_10002750 3300013308 Viruses 15208
43 Ga0157375_10063416 3300013308 Bacteria 3676
44 Ga0157375_10079339 3300013308 Bacteria 3318
45 Ga0157375_10130929 3300013308 Bacteria 2628
46 Ga0157375_10224701 3300013308 Bacteria 2036
47 Ga0157375_10450796 3300013308 Viruses 1452
48 Ga0157375_10541131 3300013308 Bacteria 1327
49 Ga0157375_10561446 3300013308 Archaea 1303
50 Ga0157375_10890671 3300013308 Viruses 1034
51 Ga0157375_10961649 3300013308 Viruses 995
52 Ga0157375_11209074 3300013308 Unclassified 887
53 Ga0163161_10003945 3300017792 Bacteria 10410
54 Ga0163161_10286199 3300017792 Viruses 1294
55 Ga0163161_10384226 3300017792 Bacteria 1123
56 Ga0207655_1005678 3300025728 Bacteria 8436
57 Ga0207698_10082202 3300026142 Bacteria 2603
58 Ga0307408_100017683 3300031548 Viruses 4775
59 Ga0307408_100072797 3300031548 Viruses 2545
60 Ga0307408_100134779 3300031548 Viruses 1931
61 Ga0307408_100305482 3300031548 Unclassified 1334
62 Ga0307405_10146012 3300031731 Viruses 1657
63 Ga0307413_10047434 3300031824 Viruses 2561
64 Ga0307413_10174644 3300031824 Bacteria 1525
65 Ga0307410_10077092 3300031852 Unclassified 2329
66 Ga0307410_10172322 3300031852 Bacteria 1632
67 Ga0307407_10001050 3300031903 Bacteria 9559
68 Ga0307412_10014493 3300031911 Bacteria 4649
69 Ga0307412_10039006 3300031911 Viruses 3063
70 Ga0307412_10062837 3300031911 Unclassified 2502
71 Ga0307412_10205712 3300031911 Bacteria 1498
72 Ga0307412_10297542 3300031911 Unclassified 1274
73 Ga0307416_100000165 3300032002 Bacteria 37531
74 Ga0307416_100243740 3300032002 Viruses 1744
75 Ga0307414_10073821 3300032004 Bacteria 2469
76 Ga0307411_10000082 3300032005 Viruses 29336
77 Ga0395899_0000600 3300037312 Bacteria 37789
78 Ga0395900_0000950 3300037418 Bacteria 37793
79 Ga0395900_0479808 3300037418 Bacteria 1196
80 Ga0395898_0000674 3300037466 Bacteria 61780
81 Ga0395905_0093566 3300037471 Bacteria 2819
82 Ga0439438_004178 3300041405 Bacteria 5618
83 Ga0439442_000951 3300042002 Bacteria 5890
84 Ga0439442_002042 3300042002 Bacteria 3967
85 Ga0439442_004421 3300042002 Viruses 2792
86 Ga0466957_0000051 3300044842 Bacteria 43639
87 Ga0495664_0035608 3300046477 Viruses 2932
88 Ga0495596_0000122 3300046500 Bacteria 53601
89 Ga0495606_0000651 3300046507 Bacteria 54697
90 Ga0495628_0039116 3300046516 Bacteria 3794
91 Ga0495631_0018286 3300046518 Unclassified 3301
92 Ga0495643_0022166 3300046522 Viruses 3628
93 Ga0495654_0000177 3300046530 Bacteria 62703
94 Ga0495665_0004055 3300046531 Bacteria 7908
95 Ga0495586_0000585 3300046535 Viruses 21153
96 Ga0495586_0037733 3300046535 Bacteria 2594
97 Ga0495586_0047509 3300046535 Bacteria 2317
98 Ga0495587_0025084 3300046536 Bacteria 3646
99 Ga0495645_0035293 3300046543 Viruses 3646
100 Ga0495645_0121131 3300046543 Bacteria 1842
101 Ga0495622_0024908 3300046557 Viruses 2794
102 Ga0495667_0001858 3300046559 Bacteria 13996
103 Ga0495668_0001084 3300046616 Bacteria 28382
104 Ga0495668_0003659 3300046616 Bacteria 11358
105 Ga0495668_0006298 3300046616 Bacteria 7816
106 Ga0495588_0000231 3300046674 Bacteria 49904
107 Ga0495623_0029635 3300046679 Bacteria 3521
108 Ga0495581_0082916 3300047315 Viruses 1857
109 Ga0495581_0152498 3300047315 Bacteria 1350
110 Ga0495581_0167355 3300047315 Bacteria 1285
111 Ga0495581_0230931 3300047315 Viruses 1082
112 Ga0495604_0362648 3300047317 Unclassified 961
113 Ga0495675_0013742 3300047444 Bacteria 5117
114 Ga0495675_0038040 3300047444 Bacteria 3064
115 Ga0495675_0112865 3300047444 Unclassified 1695
116 Ga0495675_0156148 3300047444 Viruses 1407
117 Ga0495675_0272131 3300047444 Bacteria 1012
118 Ga0495681_0064335 3300047470 Bacteria 1680
119 Ga0496102_0076254 3300048905 Bacteria 3084
120 Ga0496109_0291954 3300048912 Unclassified 1537
121 Ga0496114_0198728 3300048917 Bacteria 1756
122 Ga0501279_000081 3300049775 Viruses 16039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046616 Ga0495668_0006298 Ga0495668_0006298_3299_3862 185
2 3300005616 Ga0068852_100245746 Ga0068852_1002457462 201
3 3300013307 Ga0157372_10005941 Ga0157372_1000594114 201
4 3300026142 Ga0207698_10082202 Ga0207698_100822022 201
5 3300013100 Ga0157373_10013774 Ga0157373_100137746 204
6 3300013104 Ga0157370_10299936 Ga0157370_102999361 204
7 3300013306 Ga0163162_10007783 Ga0163162_1000778311 204
8 3300013306 Ga0163162_10039513 Ga0163162_100395135 204
9 3300013308 Ga0157375_10961649 Ga0157375_109616492 204
10 3300037418 Ga0395900_0479808 Ga0395900_0479808_404_1018 204
11 3300046518 Ga0495631_0018286 Ga0495631_0018286_2665_3279 204
12 3300046543 Ga0495645_0121131 Ga0495645_0121131_1046_1669 206
13 3300046477 Ga0495664_0035608 Ga0495664_0035608_373_1029 208
14 3300013104 Ga0157370_10064468 Ga0157370_100644688 215
15 3300031731 Ga0307405_10146012 Ga0307405_101460122 215
16 3300048917 Ga0496114_0198728 Ga0496114_0198728_1049_1696 215
17 3300013296 Ga0157374_10288397 Ga0157374_102883973 216
18 3300005288 Ga0065714_10065953 Ga0065714_100659536 217
19 3300005288 Ga0065714_10070738 Ga0065714_100707388 217
20 3300005288 Ga0065714_10083578 Ga0065714_100835782 217
21 3300005288 Ga0065714_10112221 Ga0065714_101122213 217
22 3300005288 Ga0065714_10112449 Ga0065714_101124493 217
23 3300009036 Ga0105244_10019141 Ga0105244_100191415 217
24 3300013100 Ga0157373_10037055 Ga0157373_100370556 217
25 3300013102 Ga0157371_10032978 Ga0157371_100329788 217
26 3300013102 Ga0157371_10169299 Ga0157371_101692992 217
27 3300013102 Ga0157371_10523626 Ga0157371_105236262 217
28 3300013104 Ga0157370_10047170 Ga0157370_100471702 217
29 3300013105 Ga0157369_10030288 Ga0157369_1003028811 217
30 3300013105 Ga0157369_10063499 Ga0157369_100634994 217
31 3300013105 Ga0157369_10127826 Ga0157369_101278262 217
32 3300013105 Ga0157369_10591775 Ga0157369_105917752 217
33 3300013306 Ga0163162_10090200 Ga0163162_100902004 217
34 3300013306 Ga0163162_10361649 Ga0163162_103616494 217
35 3300013306 Ga0163162_10423634 Ga0163162_104236342 217
36 3300013306 Ga0163162_10424964 Ga0163162_104249642 217
37 3300013306 Ga0163162_10509380 Ga0163162_105093802 217
38 3300013306 Ga0163162_10552254 Ga0163162_105522542 217
39 3300013306 Ga0163162_10728339 Ga0163162_107283392 217
40 3300013308 Ga0157375_10063416 Ga0157375_100634165 217
41 3300013308 Ga0157375_10130929 Ga0157375_101309292 217
42 3300013308 Ga0157375_10450796 Ga0157375_104507962 217
43 3300013308 Ga0157375_10541131 Ga0157375_105411312 217
44 3300013308 Ga0157375_10561446 Ga0157375_105614463 217
45 3300013308 Ga0157375_10890671 Ga0157375_108906712 217
46 3300013308 Ga0157375_11209074 Ga0157375_112090742 217
47 3300017792 Ga0163161_10003945 Ga0163161_1000394510 217
48 3300017792 Ga0163161_10286199 Ga0163161_102861993 217
49 3300031548 Ga0307408_100017683 Ga0307408_1000176836 217
50 3300031548 Ga0307408_100134779 Ga0307408_1001347793 217
51 3300031548 Ga0307408_100305482 Ga0307408_1003054821 217
52 3300031852 Ga0307410_10172322 Ga0307410_101723222 217
53 3300031903 Ga0307407_10001050 Ga0307407_1000105017 217
54 3300031911 Ga0307412_10014493 Ga0307412_100144932 217
55 3300031911 Ga0307412_10039006 Ga0307412_100390063 217
56 3300031911 Ga0307412_10062837 Ga0307412_100628373 217
57 3300032002 Ga0307416_100000165 Ga0307416_10000016523 217
58 3300037312 Ga0395899_0000600 Ga0395899_0000600_27350_28003 217
59 3300037418 Ga0395900_0000950 Ga0395900_0000950_7863_8516 217
60 3300037466 Ga0395898_0000674 Ga0395898_0000674_51341_51994 217
61 3300037471 Ga0395905_0093566 Ga0395905_0093566_52_705 217
62 3300042002 Ga0439442_000951 Ga0439442_000951_1166_1819 217
63 3300046522 Ga0495643_0022166 Ga0495643_0022166_2536_3189 217
64 3300046531 Ga0495665_0004055 Ga0495665_0004055_247_927 217
65 3300046535 Ga0495586_0037733 Ga0495586_0037733_837_1490 217
66 3300046535 Ga0495586_0047509 Ga0495586_0047509_444_1121 217
67 3300046543 Ga0495645_0035293 Ga0495645_0035293_605_1258 217
68 3300046559 Ga0495667_0001858 Ga0495667_0001858_403_1056 217
69 3300046616 Ga0495668_0001084 Ga0495668_0001084_8306_8959 217
70 3300047315 Ga0495581_0082916 Ga0495581_0082916_560_1213 217
71 3300047315 Ga0495581_0152498 Ga0495581_0152498_99_752 217
72 3300047315 Ga0495581_0167355 Ga0495581_0167355_385_1038 217
73 3300047315 Ga0495581_0230931 Ga0495581_0230931_324_1034 217
74 3300047444 Ga0495675_0013742 Ga0495675_0013742_3893_4570 217
75 3300047444 Ga0495675_0112865 Ga0495675_0112865_196_876 217
76 3300047444 Ga0495675_0156148 Ga0495675_0156148_265_918 217
77 3300048905 Ga0496102_0076254 Ga0496102_0076254_190_870 217
78 3300013100 Ga0157373_10047475 Ga0157373_100474755 218
79 3300013105 Ga0157369_10096185 Ga0157369_100961852 218
80 3300013105 Ga0157369_10102645 Ga0157369_101026454 218
81 3300017792 Ga0163161_10384226 Ga0163161_103842263 218
82 3300031548 Ga0307408_100072797 Ga0307408_1000727974 218
83 3300031824 Ga0307413_10047434 Ga0307413_100474342 218
84 3300031852 Ga0307410_10077092 Ga0307410_100770923 218
85 3300031911 Ga0307412_10205712 Ga0307412_102057122 218
86 3300032002 Ga0307416_100243740 Ga0307416_1002437402 218
87 3300032005 Ga0307411_10000082 Ga0307411_1000008224 218
88 3300047470 Ga0495681_0064335 Ga0495681_0064335_243_917 218
89 3300048912 Ga0496109_0291954 Ga0496109_0291954_67_756 218
90 3300013308 Ga0157375_10224701 Ga0157375_102247013 219
91 3300032004 Ga0307414_10073821 Ga0307414_100738215 219
92 3300046536 Ga0495587_0025084 Ga0495587_0025084_873_1628 219
93 3300047444 Ga0495675_0272131 Ga0495675_0272131_184_939 219
94 3300013102 Ga0157371_10006713 Ga0157371_1000671323 220
95 3300031824 Ga0307413_10174644 Ga0307413_101746443 220
96 3300046535 Ga0495586_0000585 Ga0495586_0000585_15723_16481 220
97 3300044842 Ga0466957_0000051 Ga0466957_0000051_4659_5360 221
98 3300046500 Ga0495596_0000122 Ga0495596_0000122_37631_38305 221
99 3300046507 Ga0495606_0000651 Ga0495606_0000651_49506_50174 221
100 3300046516 Ga0495628_0039116 Ga0495628_0039116_1769_2437 221
101 3300046530 Ga0495654_0000177 Ga0495654_0000177_5388_6062 221
102 3300046557 Ga0495622_0024908 Ga0495622_0024908_190_882 221
103 3300046616 Ga0495668_0003659 Ga0495668_0003659_7402_8076 221
104 3300046674 Ga0495588_0000231 Ga0495588_0000231_31073_31765 221
105 3300046679 Ga0495623_0029635 Ga0495623_0029635_1175_1843 221
106 3300047317 Ga0495604_0362648 Ga0495604_0362648_159_827 221
107 3300047444 Ga0495675_0038040 Ga0495675_0038040_715_1383 221
108 3300049775 Ga0501279_000081 Ga0501279_000081_10559_11245 221
109 3300005288 Ga0065714_10064712 Ga0065714_1006471216 222
110 3300005288 Ga0065714_10136489 Ga0065714_101364891 222
111 3300009036 Ga0105244_10001153 Ga0105244_100011538 222
112 3300009036 Ga0105244_10112225 Ga0105244_101122252 222
113 3300013104 Ga0157370_10073541 Ga0157370_100735414 222
114 3300013105 Ga0157369_10005005 Ga0157369_1000500521 222
115 3300013308 Ga0157375_10002750 Ga0157375_1000275015 222
116 3300013308 Ga0157375_10079339 Ga0157375_100793397 222
117 3300025728 Ga0207655_1005678 Ga0207655_10056789 222
118 3300031911 Ga0307412_10297542 Ga0307412_102975421 222
119 3300042002 Ga0439442_002042 Ga0439442_002042_2846_3517 222
120 3300042002 Ga0439442_004421 Ga0439442_004421_691_1362 222
121 3300041405 Ga0439438_004178 Ga0439438_004178_3527_4207 225
122 3300005288 Ga0065714_10002391 Ga0065714_1000239141 230

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lg1-assembly1.cif.gz_B human methyltransferase-like protein 21d 0.6518 3 32
4fd3-assembly2.cif.gz_E crystal structure of apo-formed ymtoar1 0.6491 1 31
4ztc-assembly1.cif.gz_A-2 pgle aminotransferase in complex with external aldimine, mutant k184a 0.6267 1 76
3lsh-assembly1.cif.gz_B pyranose 2-oxidase t169a, monoclinic 0.6004 5 32
4mol-assembly1.cif.gz_A pyranose 2-oxidase h167a mutant with 2-fluorinated galactose 0.5961 5 32
ID Description Score Start End Superfamily
af_A4HXF2_86_160_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7677 3 32 3.40.50.150
af_Q67UJ7_79_379_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7498 28 55 3.60.21.10
af_O42841_61_339_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6939 28 54 3.60.21.10
5b54A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6425 2 32 3.40.50.1100
af_Q4KM84_128_344_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6286 3 83 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A848J669-F1-model_v4 deleted 0.942 5 174
AF-A0A5B0WFG3-F1-model_v4 DNA cytosine methyltransferase 0.9231 37 219
AF-A0A8B2R1E6-F1-model_v4 deleted 0.9229 51 220
AF-A0A848J669-F1-model_v4 deleted 0.9204 5 174
AF-A0A1V8RP18-F1-model_v4 DNA cytosine methyltransferase 0.913 4 224

Feature Viewer

pLDDT pTM Quality
86.04 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map