F112885

General Info

Members Datasets Scaffolds Average Seq Length
122 86 244 666

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100039430|Ga0070670_1000394302
Length 737
Sequence VAREYHLTSPAGPTSLRIDYERSLNPQQFAAVSAPNGAALVLAGAXXXKTRTLTYRVAWLLEHGTPPDRILLLTFTNKSAREMMQRVNALLPGDIGRLWGGTFHSIGLRILRRHSERLNYQPGFTVADREDAEDLLASCIVDAGIDVKTTRFPKAQVLGNIFSLAINTGRTVREEVEANHPLFVALSDEISRVQGAYAERKRRAAVMDFDDLLALWLQLLREHADVAELYQRRFHHVLVDEYQDTNRLQSDLLDTLALRHGNLMAVGDDAQSIYSWRGANFANILDFPRRYPQAQVFKVETNYRSTPEILALANSVIMHNVRQFPKILQAARTPGGKPAMVTATDAYEQAAFIAERTLELRDEGVPLKEICVLYRSHFHALELQLELVRRNIPFVITSGIRFFEQAHIKDVTAYLKLLHNPWDELAFKRLVRLLPGVGGKGAEKLWSHFSNRVQQAAPTLQLPAAAVWAVPVSYSDNDGELSDEPPVAMDSRPTVPVATLLRAMSDVVGKKTAPGWDRFTKAMERISSVTLREAPGECLRQVLAIDYDEHLEVNYENARKRREEIEQLAVYADQFRSGTDFLSQLALQTNLEAEQEQRRSVEDDDERLRLSTVHQAKGLEFTAVFVIMLCDGLFPSGRSMESGDGQEEERRLFYVAVTRAKTELYLCRPLIRFTPGAGEAMQMPSRFLVEIEPDLMEQIDVVSPNASAYRSAGSRWSGGLGYSSDSQPDPPDDSTPF

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
4 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
7 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
13 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
24 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
25 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
26 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
40 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
41 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
42 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
43 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
44 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
45 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
46 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
49 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
55 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
56 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
57 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
58 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
59 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
60 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
65 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
69 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
75 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
78 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
79 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
80 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
83 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
84 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
85 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
86 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 0
Rhizosphere 93.44
Stem 0
Stem Tuber 0
Unclassified 3.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100039430 3300005331 Bacteria 4062
2 Ga0070666_10004511 3300005335 Bacteria 8484
3 Ga0070711_100000453 3300005439 Bacteria 21418
4 Ga0070694_100005962 3300005444 Bacteria 7390
5 Ga0070706_100018627 3300005467 Bacteria 6401
6 Ga0070699_100003364 3300005518 Bacteria 14144
7 Ga0070699_100020279 3300005518 Bacteria 5732
8 Ga0070697_100018549 3300005536 Bacteria 5486
9 Ga0070697_100020619 3300005536 Bacteria 5217
10 Ga0068855_100000005 3300005563 Bacteria 337711
11 Ga0068855_100000990 3300005563 Bacteria 35322
12 Ga0068852_100055758 3300005616 Bacteria 3412
13 Ga0068862_100029744 3300005844 Bacteria 4603
14 Ga0070717_10014687 3300006028 Bacteria 6026
15 Ga0075368_10000954 3300006042 Bacteria 8997
16 Ga0075436_100052796 3300006914 Bacteria 2806
17 Ga0105240_10001037 3300009093 Bacteria 49391
18 Ga0105240_10002189 3300009093 Bacteria 31899
19 Ga0111539_10004792 3300009094 Bacteria 17653
20 Ga0114129_10287309 3300009147 Bacteria 2196
21 Ga0105243_10001804 3300009148 Bacteria 18393
22 Ga0105238_10025328 3300009551 Bacteria 6047
23 Ga0157374_10019440 3300013296 Bacteria 6011
24 Ga0163162_10021785 3300013306 Bacteria 6312
25 Ga0157375_10000366 3300013308 Bacteria 41269
26 Ga0163163_10000050 3300014325 Bacteria 128713
27 Ga0157376_10061120 3300014969 Bacteria 3166
28 Ga0213876_10017313 3300021384 Bacteria 3804
29 Ga0213875_10003167 3300021388 Bacteria 9459
30 Ga0207684_10000609 3300025910 Bacteria 42563
31 Ga0207684_10000860 3300025910 Bacteria 34848
32 Ga0207695_10002087 3300025913 Bacteria 30417
33 Ga0207663_10001204 3300025916 Bacteria 11953
34 Ga0207646_10019527 3300025922 Bacteria 6296
35 Ga0207646_10056278 3300025922 Bacteria 3516
36 Ga0207694_10008313 3300025924 Bacteria 7846
37 Ga0207700_10063560 3300025928 Bacteria 2808
38 Ga0207664_10004522 3300025929 Bacteria 9422
39 Ga0207709_10001226 3300025935 Bacteria 18425
40 Ga0207691_10087689 3300025940 Bacteria 2792
41 Ga0207667_10000027 3300025949 Bacteria 337700
42 Ga0207668_10047011 3300025972 Bacteria 2953
43 Ga0207698_10074448 3300026142 Bacteria 2709
44 Ga0268265_10008979 3300028380 Bacteria 6762
45 Ga0265337_1002126 3300028556 Bacteria 9341
46 Ga0265338_10002105 3300028800 Bacteria 30714
47 Ga0265332_10000115 3300031238 Bacteria 67467
48 Ga0265332_10006527 3300031238 Bacteria 5289
49 Ga0265332_10010631 3300031238 Bacteria 4096
50 Ga0265328_10014506 3300031239 Bacteria 3102
51 Ga0265320_10010247 3300031240 Bacteria 5591
52 Ga0265339_10000944 3300031249 Bacteria 22322
53 Ga0265339_10010646 3300031249 Bacteria 5699
54 Ga0265331_10000494 3300031250 Bacteria 37269
55 Ga0265331_10015140 3300031250 Bacteria 4083
56 Ga0265327_10005488 3300031251 Bacteria 10568
57 Ga0265316_10000269 3300031344 Bacteria 58721
58 Ga0265316_10003832 3300031344 Bacteria 15104
59 Ga0265316_10016917 3300031344 Bacteria 6313
60 Ga0316575_10009747 3300031665 Bacteria 3521
61 Ga0316579_10000140 3300031691 Bacteria 20131
62 Ga0316579_10015563 3300031691 Bacteria 3306
63 Ga0265314_10000466 3300031711 Bacteria 53895
64 Ga0265314_10000745 3300031711 Bacteria 39052
65 Ga0265314_10000794 3300031711 Bacteria 37489
66 Ga0265342_10000052 3300031712 Bacteria 123865
67 Ga0316576_10039089 3300031727 Bacteria 3405
68 Ga0316578_10008441 3300031728 Bacteria 5242
69 Ga0316578_10031394 3300031728 Bacteria 3026
70 Ga0316583_10000224 3300032133 Bacteria 15182
71 Ga0316585_10006290 3300032137 Bacteria 3389
72 Ga0373954_0007750 3300035118 Bacteria 4698
73 Ga0373956_0009165 3300035119 Bacteria 4015
74 Ga0316574_0002232 3300035398 Bacteria 9636
75 Ga0316574_0077067 3300035398 Bacteria 2112
76 Ga0373935_0006993 3300035692 Bacteria 6736
77 Ga0373935_0075281 3300035692 Bacteria 2184
78 Ga0373927_0013732 3300035695 Bacteria 5378
79 Ga0373927_0020258 3300035695 Bacteria 4362
80 Ga0373933_0013835 3300035724 Bacteria 4477
81 Ga0373947_0007758 3300035725 Bacteria 6200
82 Ga0373937_0020758 3300036401 Bacteria 5891
83 Ga0373937_0086588 3300036401 Unclassified 2899
84 Ga0316582_0000252 3300036647 Bacteria 17895
85 Ga0316582_0006106 3300036647 Bacteria 6282
86 Ga0316582_0013966 3300036647 Bacteria 4541
87 Ga0316584_0009282 3300036712 Bacteria 6820
88 Ga0316584_0028973 3300036712 Bacteria 4087
89 Ga0316584_0043308 3300036712 Bacteria 3356
90 Ga0373925_0001940 3300037068 Bacteria 17113
91 Ga0436364_0320847 3300037853 Bacteria 68018
92 Ga0400490_48417 3300038726 Bacteria 76530
93 Ga0400489_18545 3300039093 Bacteria 20408
94 Ga0436365_1432120 3300039437 Bacteria 33957
95 Ga0436365_1622417 3300039437 Bacteria 2930
96 Ga0451577_0009966 3300042876 Bacteria 9108
97 Ga0453684_0000001 3300044712 Bacteria 2623166
98 Ga0453684_0003815 3300044712 Bacteria 33236
99 Ga0453684_0003958 3300044712 Bacteria 32396
100 Ga0453684_0005157 3300044712 Bacteria 26279
101 Ga0453684_0012301 3300044712 Bacteria 14161
102 Ga0453684_0015485 3300044712 Bacteria 12051
103 Ga0453684_0042936 3300044712 Archaea 6086
104 Ga0453684_0044441 3300044712 Bacteria 5943
105 Ga0495638_0000061 3300046460 Bacteria 188551
106 Ga0495582_0025312 3300046473 Unclassified 3251
107 Ga0495662_0021383 3300046476 Unclassified 3128
108 Ga0495630_0000159 3300046517 Bacteria 52732
109 Ga0495630_0030622 3300046517 Bacteria 4004
110 Ga0495666_0005846 3300046526 Bacteria 6201
111 Ga0495586_0000014 3300046535 Bacteria 131102
112 Ga0495586_0003347 3300046535 Bacteria 8593
113 Ga0495634_0017014 3300046642 Bacteria 5194
114 Ga0495658_0007797 3300046683 Bacteria 5300
115 Ga0495613_0015572 3300046689 Bacteria 5657
116 Ga0495613_0046128 3300046689 Unclassified 3223
117 Ga0495674_0026696 3300047319 Bacteria 5282
118 Ga0495676_0002997 3300047321 Bacteria 15280
119 Ga0495676_0072427 3300047321 Bacteria 2646
120 nmdc:mga08y16_18360_c1 3300050511 Bacteria 7372
121 Ga0501084_0025672 3300054114 Bacteria 4913
122 2524001121 2523533628 Bacteria 4098242
123 Ga0070670_100039430
124 Ga0070666_10004511
125 Ga0070711_100000453
126 Ga0070694_100005962
127 Ga0070706_100018627
128 Ga0070699_100003364
129 Ga0070699_100020279
130 Ga0070697_100018549
131 Ga0070697_100020619
132 Ga0068855_100000005
133 Ga0068855_100000990
134 Ga0068852_100055758
135 Ga0068862_100029744
136 Ga0070717_10014687
137 Ga0075368_10000954
138 Ga0075436_100052796
139 Ga0105240_10001037
140 Ga0105240_10002189
141 Ga0111539_10004792
142 Ga0114129_10287309
143 Ga0105243_10001804
144 Ga0105238_10025328
145 Ga0157374_10019440
146 Ga0163162_10021785
147 Ga0157375_10000366
148 Ga0163163_10000050
149 Ga0157376_10061120
150 Ga0213876_10017313
151 Ga0213875_10003167
152 Ga0207684_10000609
153 Ga0207684_10000860
154 Ga0207695_10002087
155 Ga0207663_10001204
156 Ga0207646_10019527
157 Ga0207646_10056278
158 Ga0207694_10008313
159 Ga0207700_10063560
160 Ga0207664_10004522
161 Ga0207709_10001226
162 Ga0207691_10087689
163 Ga0207667_10000027
164 Ga0207668_10047011
165 Ga0207698_10074448
166 Ga0268265_10008979
167 Ga0265337_1002126
168 Ga0265338_10002105
169 Ga0265332_10000115
170 Ga0265332_10006527
171 Ga0265332_10010631
172 Ga0265328_10014506
173 Ga0265320_10010247
174 Ga0265339_10000944
175 Ga0265339_10010646
176 Ga0265331_10000494
177 Ga0265331_10015140
178 Ga0265327_10005488
179 Ga0265316_10000269
180 Ga0265316_10003832
181 Ga0265316_10016917
182 Ga0316575_10009747
183 Ga0316579_10000140
184 Ga0316579_10015563
185 Ga0265314_10000466
186 Ga0265314_10000745
187 Ga0265314_10000794
188 Ga0265342_10000052
189 Ga0316576_10039089
190 Ga0316578_10008441
191 Ga0316578_10031394
192 Ga0316583_10000224
193 Ga0316585_10006290
194 Ga0373954_0007750
195 Ga0373956_0009165
196 Ga0316574_0002232
197 Ga0316574_0077067
198 Ga0373935_0006993
199 Ga0373935_0075281
200 Ga0373927_0013732
201 Ga0373927_0020258
202 Ga0373933_0013835
203 Ga0373947_0007758
204 Ga0373937_0020758
205 Ga0373937_0086588
206 Ga0316582_0000252
207 Ga0316582_0006106
208 Ga0316582_0013966
209 Ga0316584_0009282
210 Ga0316584_0028973
211 Ga0316584_0043308
212 Ga0373925_0001940
213 Ga0436364_0320847
214 Ga0400490_48417
215 Ga0400489_18545
216 Ga0436365_1432120
217 Ga0436365_1622417
218 Ga0451577_0009966
219 Ga0453684_0000001
220 Ga0453684_0003815
221 Ga0453684_0003958
222 Ga0453684_0005157
223 Ga0453684_0012301
224 Ga0453684_0015485
225 Ga0453684_0042936
226 Ga0453684_0044441
227 Ga0495638_0000061
228 Ga0495582_0025312
229 Ga0495662_0021383
230 Ga0495630_0000159
231 Ga0495630_0030622
232 Ga0495666_0005846
233 Ga0495586_0000014
234 Ga0495586_0003347
235 Ga0495634_0017014
236 Ga0495658_0007797
237 Ga0495613_0015572
238 Ga0495613_0046128
239 Ga0495674_0026696
240 Ga0495676_0002997
241 Ga0495676_0072427
242 nmdc:mga08y16_18360_c1
243 Ga0501084_0025672
244 2524001121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00580

UvrD-helicase

UvrD/REP helicase N-terminal domain

24

292

0.94

PF13245

AAA_19

AAA domain

27

277

0.89

PF13361

UvrD_C

UvrD-like helicase C-terminal domain

297

668

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pjr-assembly1.cif.gz_G helicase product complex 0.9381 609 694
2is1-assembly1.cif.gz_A crystal structure of uvrd-dna-so4 complex 0.9002 21 700
4c30-assembly2.cif.gz_I crystal structure of deinococcus radiodurans uvrd in complex with dna, form 2 0.8986 22 697
4c30-assembly1.cif.gz_D crystal structure of deinococcus radiodurans uvrd in complex with dna, form 2 0.8963 22 697
2is1-assembly1.cif.gz_A crystal structure of uvrd-dna-so4 complex 0.8855 21 700
ID Description Score Start End Superfamily
2pjrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9582 24 296 3.40.50.300
2pjrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9485 24 296 3.40.50.300
2pjrF03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9412 297 398 3.40.50.300
4c2tA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.939 297 700 3.40.50.300
1uaaA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9332 297 693 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A349A1X8-F1-model_v4 ATP-dependent DNA helicase 0.9771 18 353 GO:0000725
GO:0003677
GO:0005524
GO:0005829
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518
AF-A0A2M6P356-F1-model_v4 ATP-dependent DNA helicase 0.9724 18 335 GO:0000725
GO:0003677
GO:0005524
GO:0005829
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518
AF-A0A532E923-F1-model_v4 ATP-dependent helicase 0.9674 8 322 GO:0000725
GO:0003677
GO:0005524
GO:0005829
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518
AF-A0A2H0TX77-F1-model_v4 ATP-dependent DNA helicase 0.9673 22 223 GO:0000725
GO:0003677
GO:0005524
GO:0005829
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518
AF-A0A0G0ZYQ8-F1-model_v4 UvrD/REP helicase 0.9658 18 254 GO:0000725
GO:0003677
GO:0005524
GO:0005829
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518

Map