F112423

General Info

Members Datasets Scaffolds Average Seq Length
122 94 122 165

Family's Representative Sequence

Representative Sequence 3300002244|JGI24742J22300_10000011|JGI24742J22300_1000001115
Length 181
Sequence MSAIIFCEVEAATYTGGVKQIILIAHNLRSCHNVGSLLRTAEGLGVSKVFLTGYTPYPTHSGDTRLPHLAAKIHKQIHKTALGAETFIAWEHSEALAPVLAKLQQEGFTIAAIEQAPRAIPLPKYKTPDKIVLLVGREVEGVEPEVLARMDTVLEIPMFGKKESYNVVQAAAMGMYHCRFH

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
66 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
67 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
68 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
69 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
70 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
71 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
72 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
73 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
74 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
75 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
76 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
77 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
78 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
79 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
80 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
81 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
82 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
83 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
84 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
85 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
86 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
87 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
88 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
89 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
90 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
91 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
92 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
93 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
94 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 36.89
Nodule 0
Rhizoplane 0
Rhizosphere 62.3
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000228 3300001990 Bacteria 18575
2 JGI24735J21928_10000227 3300002067 Bacteria 19785
3 JGI24742J22300_10000011 3300002244 Bacteria 31137
4 rootH1_10189042 3300003323 Bacteria 5626
5 Ga0070658_10002596 3300005327 Bacteria 15044
6 Ga0070676_10001822 3300005328 Bacteria 10833
7 Ga0070683_100003448 3300005329 Bacteria 12841
8 Ga0070690_100097574 3300005330 Bacteria 1944
9 Ga0068869_100436242 3300005334 Bacteria 1083
10 Ga0070680_100005630 3300005336 Bacteria 9490
11 Ga0070668_100582258 3300005347 Unclassified 977
12 Ga0070667_100013945 3300005367 Bacteria 6644
13 Ga0070678_100747606 3300005456 Unclassified 884
14 Ga0068867_100857109 3300005459 Bacteria 814
15 Ga0070679_100010000 3300005530 Bacteria 8980
16 Ga0070679_100382930 3300005530 Bacteria 1353
17 Ga0070684_100001437 3300005535 Bacteria 17157
18 Ga0070684_100549783 3300005535 Unclassified 1071
19 Ga0070686_100036440 3300005544 Bacteria 3046
20 Ga0068855_100000003 3300005563 Bacteria 589862
21 Ga0068855_100269652 3300005563 Bacteria 1893
22 Ga0068857_100111939 3300005577 Bacteria 2454
23 Ga0068856_100046085 3300005614 Bacteria 4295
24 Ga0068856_100632414 3300005614 Unclassified 1091
25 Ga0068863_100971576 3300005841 Unclassified 851
26 Ga0068860_100086076 3300005843 Unclassified 2990
27 Ga0075365_10017014 3300006038 Unclassified 4440
28 Ga0075365_10210006 3300006038 Bacteria 1365
29 Ga0075365_10999246 3300006038 Bacteria 590
30 Ga0075364_10044779 3300006051 Bacteria 2879
31 Ga0075366_10000044 3300006195 Bacteria 45021
32 Ga0075366_10008110 3300006195 Bacteria 5825
33 Ga0075366_10054948 3300006195 Bacteria 2365
34 Ga0075366_10189127 3300006195 Bacteria 1251
35 Ga0075366_10275342 3300006195 Unclassified 1028
36 Ga0075428_100232326 3300006844 Bacteria 1990
37 Ga0075430_100028749 3300006846 Unclassified 4721
38 Ga0105240_11077782 3300009093 Unclassified 856
39 Ga0111539_10001909 3300009094 Bacteria 27751
40 Ga0105247_10137912 3300009101 Bacteria 1596
41 Ga0105241_10000003 3300009174 Bacteria 839043
42 Ga0105248_10402020 3300009177 Bacteria 1542
43 Ga0105249_10356147 3300009553 Bacteria 1484
44 Ga0105249_10649707 3300009553 Unclassified 1112
45 Ga0105030_105202 3300009987 Unclassified 1100
46 Ga0105239_10834092 3300010375 Unclassified 1057
47 Ga0157369_10003103 3300013105 Bacteria 19847
48 Ga0157374_10002560 3300013296 Bacteria 15342
49 Ga0157372_10032188 3300013307 Bacteria 5748
50 Ga0163163_10040929 3300014325 Bacteria 4529
51 Ga0207647_10052334 3300025904 Bacteria 2520
52 Ga0207645_10001792 3300025907 Bacteria 17339
53 Ga0207705_10001854 3300025909 Bacteria 16602
54 Ga0207654_10000002 3300025911 Bacteria 1460142
55 Ga0207660_10008103 3300025917 Bacteria 6798
56 Ga0207662_10406138 3300025918 Unclassified 924
57 Ga0207657_10038163 3300025919 Bacteria 4280
58 Ga0207652_10005637 3300025921 Bacteria 10158
59 Ga0207689_10434235 3300025942 Bacteria 1097
60 Ga0207661_10000021 3300025944 Bacteria 205381
61 Ga0207667_10000008 3300025949 Bacteria 625138
62 Ga0207667_10059320 3300025949 Bacteria 4008
63 Ga0207712_10387594 3300025961 Bacteria 1171
64 Ga0207658_10000003 3300025986 Bacteria 1151934
65 Ga0207658_10035366 3300025986 Bacteria 3577
66 Ga0207702_10006320 3300026078 Bacteria 10235
67 Ga0207648_10881841 3300026089 Bacteria 835
68 Ga0207674_10131668 3300026116 Bacteria 2464
69 Ga0209998_10005866 3300027717 Bacteria 2555
70 Ga0207428_10011222 3300027907 Bacteria 7943
71 Ga0265338_10015651 3300028800 Bacteria 8311
72 Ga0265327_10012154 3300031251 Bacteria 5841
73 Ga0395900_0004371 3300037418 Bacteria 14994
74 Ga0395900_0164307 3300037418 Bacteria 2263
75 Ga0395900_0362777 3300037418 Bacteria 1420
76 Ga0395898_0015019 3300037466 Bacteria 7949
77 Ga0395905_0187241 3300037471 Unclassified 1942
78 Ga0395901_0006077 3300038443 Bacteria 12237
79 Ga0466967_0593249 3300045976 Bacteria 1093
80 Ga0495658_0548638 3300046683 Unclassified 740
81 Ga0495649_0000284 3300046694 Bacteria 44736
82 Ga0495672_0000129 3300047320 Bacteria 112879
83 Ga0495672_0148485 3300047320 Unclassified 1218
84 Ga0495602_0991151 3300048088 Unclassified 555
85 nmdc:mga03683_60539_c1 3300050489 Bacteria 1599
86 nmdc:mga00v17_34557_c1 3300050491 Bacteria 3004
87 nmdc:mga00v17_663842_c1 3300050491 Unclassified 670
88 nmdc:mga0yw44_248322_c1 3300050492 Bacteria 1184
89 nmdc:mga0yw44_449614_c1 3300050492 Bacteria 873
90 nmdc:mga0yw44_559_c1 3300050492 Bacteria 13438
91 nmdc:mga0yw44_678829_c1 3300050492 Bacteria 700
92 nmdc:mga0k408_32487_c1 3300050493 Bacteria 2982
93 nmdc:mga0k408_52434_c1 3300050493 Bacteria 2364
94 nmdc:mga0k408_8545_c1 3300050493 Bacteria 5500
95 nmdc:mga06z11_167066_c1 3300050494 Unclassified 1261
96 nmdc:mga06z11_370616_c1 3300050494 Unclassified 859
97 nmdc:mga04h51_358625_c1 3300050495 Unclassified 604
98 nmdc:mga0qj67_10614_c1 3300050509 Bacteria 6880
99 nmdc:mga08y16_1132_c1 3300050511 Bacteria 26248
100 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
101 Ga0500610_0000001 3300053079 Bacteria 185468
102 Ga0500643_003390 3300053087 Bacteria 7705
103 Ga0500644_0000006 3300053088 Bacteria 143304
104 Ga0500644_0000480 3300053088 Bacteria 17568
105 Ga0500644_0002543 3300053088 Bacteria 4556
106 Ga0500583_0000943 3300053092 Bacteria 8271
107 Ga0500651_0000045 3300053093 Bacteria 85481
108 Ga0500651_0015284 3300053093 Bacteria 4710
109 Ga0500555_000001 3300053103 Bacteria 1353713
110 Ga0500555_000002 3300053103 Bacteria 1314346
111 Ga0500594_0000196 3300053118 Bacteria 15125
112 Ga0500628_000012 3300053129 Bacteria 106556
113 Ga0500642_0139927 3300053130 Bacteria 1135
114 Ga0500652_000020 3300053131 Bacteria 119198
115 Ga0500568_0010784 3300053139 Bacteria 4263
116 Ga0500568_0125103 3300053139 Bacteria 957
117 Ga0500577_0003906 3300053142 Bacteria 3895
118 Ga0500589_000016 3300053147 Bacteria 107090
119 Ga0500604_0049905 3300053151 Bacteria 1288
120 Ga0500616_0000005 3300053153 Bacteria 961725
121 Ga0500611_019614 3300053727 Bacteria 1264
122 Ga0500599_021113 3300053736 Unclassified 925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025986 Ga0207658_10000003 Ga0207658_10000003629 145
2 3300048088 Ga0495602_0991151 Ga0495602_0991151_62_502 146
3 3300050494 nmdc:mga06z11_370616_c1 nmdc:mga06z11_370616_c1_176_616 146
4 3300005456 Ga0070678_100747606 Ga0070678_1007476062 149
5 3300025986 Ga0207658_10035366 Ga0207658_100353664 149
6 3300053118 Ga0500594_0000196 Ga0500594_0000196_12380_12829 149
7 3300046683 Ga0495658_0548638 Ga0495658_0548638_254_709 150
8 3300005329 Ga0070683_100003448 Ga0070683_1000034482 151
9 3300005535 Ga0070684_100001437 Ga0070684_10000143715 151
10 3300025944 Ga0207661_10000021 Ga0207661_1000002198 151
11 3300050493 nmdc:mga0k408_8545_c1 nmdc:mga0k408_8545_c1_5032_5490 152
12 3300050495 nmdc:mga04h51_358625_c1 nmdc:mga04h51_358625_c1_19_477 152
13 3300009101 Ga0105247_10137912 Ga0105247_101379122 163
14 3300002244 JGI24742J22300_10000011 JGI24742J22300_1000001115 164
15 3300005328 Ga0070676_10001822 Ga0070676_100018227 164
16 3300005563 Ga0068855_100269652 Ga0068855_1002696522 164
17 3300005577 Ga0068857_100111939 Ga0068857_1001119392 164
18 3300005614 Ga0068856_100046085 Ga0068856_1000460853 164
19 3300005843 Ga0068860_100086076 Ga0068860_1000860762 164
20 3300009093 Ga0105240_11077782 Ga0105240_110777822 164
21 3300009177 Ga0105248_10402020 Ga0105248_104020202 164
22 3300009553 Ga0105249_10649707 Ga0105249_106497071 164
23 3300009987 Ga0105030_105202 Ga0105030_1052021 164
24 3300013296 Ga0157374_10002560 Ga0157374_1000256012 164
25 3300014325 Ga0163163_10040929 Ga0163163_100409291 164
26 3300025904 Ga0207647_10052334 Ga0207647_100523343 164
27 3300025907 Ga0207645_10001792 Ga0207645_100017927 164
28 3300025949 Ga0207667_10059320 Ga0207667_100593202 164
29 3300026078 Ga0207702_10006320 Ga0207702_100063208 164
30 3300026116 Ga0207674_10131668 Ga0207674_101316682 164
31 3300031251 Ga0265327_10012154 Ga0265327_100121543 164
32 3300037418 Ga0395900_0004371 Ga0395900_0004371_6180_6674 164
33 3300037418 Ga0395900_0164307 Ga0395900_0164307_28_522 164
34 3300037418 Ga0395900_0362777 Ga0395900_0362777_859_1353 164
35 3300037466 Ga0395898_0015019 Ga0395898_0015019_570_1064 164
36 3300037471 Ga0395905_0187241 Ga0395905_0187241_1333_1827 164
37 3300038443 Ga0395901_0006077 Ga0395901_0006077_4929_5423 164
38 3300045976 Ga0466967_0593249 Ga0466967_0593249_119_655 164
39 3300050492 nmdc:mga0yw44_449614_c1 nmdc:mga0yw44_449614_c1_36_530 164
40 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_216885_217379 164
41 3300053092 Ga0500583_0000943 Ga0500583_0000943_3233_3727 164
42 3300053130 Ga0500642_0139927 Ga0500642_0139927_459_953 164
43 3300053139 Ga0500568_0010784 Ga0500568_0010784_1718_2212 164
44 3300053147 Ga0500589_000016 Ga0500589_000016_52637_53131 164
45 3300003323 rootH1_10189042 rootH1_101890422 165
46 3300005330 Ga0070690_100097574 Ga0070690_1000975742 165
47 3300005334 Ga0068869_100436242 Ga0068869_1004362422 165
48 3300005347 Ga0070668_100582258 Ga0070668_1005822582 165
49 3300005367 Ga0070667_100013945 Ga0070667_1000139454 165
50 3300005535 Ga0070684_100549783 Ga0070684_1005497832 165
51 3300005544 Ga0070686_100036440 Ga0070686_1000364402 165
52 3300005841 Ga0068863_100971576 Ga0068863_1009715762 165
53 3300006038 Ga0075365_10017014 Ga0075365_100170142 165
54 3300006051 Ga0075364_10044779 Ga0075364_100447793 165
55 3300006195 Ga0075366_10054948 Ga0075366_100549482 165
56 3300006195 Ga0075366_10275342 Ga0075366_102753422 165
57 3300006844 Ga0075428_100232326 Ga0075428_1002323262 165
58 3300006846 Ga0075430_100028749 Ga0075430_1000287493 165
59 3300009094 Ga0111539_10001909 Ga0111539_100019095 165
60 3300025918 Ga0207662_10406138 Ga0207662_104061382 165
61 3300025942 Ga0207689_10434235 Ga0207689_104342352 165
62 3300027907 Ga0207428_10011222 Ga0207428_100112222 165
63 3300028800 Ga0265338_10015651 Ga0265338_100156512 165
64 3300047320 Ga0495672_0148485 Ga0495672_0148485_548_1045 165
65 3300050491 nmdc:mga00v17_34557_c1 nmdc:mga00v17_34557_c1_812_1309 165
66 3300050492 nmdc:mga0yw44_559_c1 nmdc:mga0yw44_559_c1_129_626 165
67 3300050493 nmdc:mga0k408_52434_c1 nmdc:mga0k408_52434_c1_1408_1905 165
68 3300050494 nmdc:mga06z11_167066_c1 nmdc:mga06z11_167066_c1_83_580 165
69 3300050509 nmdc:mga0qj67_10614_c1 nmdc:mga0qj67_10614_c1_3479_3976 165
70 3300050511 nmdc:mga08y16_1132_c1 nmdc:mga08y16_1132_c1_19207_19704 165
71 3300053079 Ga0500610_0000001 Ga0500610_0000001_113537_114034 165
72 3300053087 Ga0500643_003390 Ga0500643_003390_4290_4787 165
73 3300053088 Ga0500644_0000006 Ga0500644_0000006_126600_127097 165
74 3300053088 Ga0500644_0000480 Ga0500644_0000480_5580_6077 165
75 3300053088 Ga0500644_0002543 Ga0500644_0002543_2576_3073 165
76 3300053103 Ga0500555_000001 Ga0500555_000001_708844_709341 165
77 3300053103 Ga0500555_000002 Ga0500555_000002_530606_531103 165
78 3300053129 Ga0500628_000012 Ga0500628_000012_49303_49800 165
79 3300053131 Ga0500652_000020 Ga0500652_000020_18661_19158 165
80 3300053139 Ga0500568_0125103 Ga0500568_0125103_82_579 165
81 3300053142 Ga0500577_0003906 Ga0500577_0003906_1537_2034 165
82 3300053151 Ga0500604_0049905 Ga0500604_0049905_667_1164 165
83 3300053153 Ga0500616_0000005 Ga0500616_0000005_343957_344454 165
84 3300053727 Ga0500611_019614 Ga0500611_019614_358_855 165
85 3300005327 Ga0070658_10002596 Ga0070658_1000259610 166
86 3300005336 Ga0070680_100005630 Ga0070680_1000056302 166
87 3300005459 Ga0068867_100857109 Ga0068867_1008571091 166
88 3300005530 Ga0070679_100010000 Ga0070679_1000100002 166
89 3300005530 Ga0070679_100382930 Ga0070679_1003829302 166
90 3300006038 Ga0075365_10999246 Ga0075365_109992461 166
91 3300006195 Ga0075366_10008110 Ga0075366_100081103 166
92 3300013307 Ga0157372_10032188 Ga0157372_100321882 166
93 3300025909 Ga0207705_10001854 Ga0207705_100018547 166
94 3300025917 Ga0207660_10008103 Ga0207660_100081036 166
95 3300025919 Ga0207657_10038163 Ga0207657_100381635 166
96 3300025921 Ga0207652_10005637 Ga0207652_100056372 166
97 3300026089 Ga0207648_10881841 Ga0207648_108818411 166
98 3300050489 nmdc:mga03683_60539_c1 nmdc:mga03683_60539_c1_1001_1501 166
99 3300050491 nmdc:mga00v17_663842_c1 nmdc:mga00v17_663842_c1_56_556 166
100 3300050492 nmdc:mga0yw44_678829_c1 nmdc:mga0yw44_678829_c1_97_597 166
101 3300053093 Ga0500651_0000045 Ga0500651_0000045_18204_18713 166
102 3300053093 Ga0500651_0015284 Ga0500651_0015284_2144_2653 166
103 3300053736 Ga0500599_021113 Ga0500599_021113_354_854 166
104 3300001990 JGI24737J22298_10000228 JGI24737J22298_1000022813 168
105 3300002067 JGI24735J21928_10000227 JGI24735J21928_100002276 168
106 3300005563 Ga0068855_100000003 Ga0068855_10000000386 168
107 3300005614 Ga0068856_100632414 Ga0068856_1006324142 168
108 3300006038 Ga0075365_10210006 Ga0075365_102100062 168
109 3300006195 Ga0075366_10000044 Ga0075366_100000442 168
110 3300006195 Ga0075366_10189127 Ga0075366_101891272 168
111 3300009174 Ga0105241_10000003 Ga0105241_10000003216 168
112 3300009553 Ga0105249_10356147 Ga0105249_103561472 168
113 3300010375 Ga0105239_10834092 Ga0105239_108340922 168
114 3300013105 Ga0157369_10003103 Ga0157369_100031035 168
115 3300025911 Ga0207654_10000002 Ga0207654_10000002993 168
116 3300025949 Ga0207667_10000008 Ga0207667_1000000885 168
117 3300025961 Ga0207712_10387594 Ga0207712_103875942 168
118 3300027717 Ga0209998_10005866 Ga0209998_100058662 168
119 3300046694 Ga0495649_0000284 Ga0495649_0000284_2768_3277 168
120 3300047320 Ga0495672_0000129 Ga0495672_0000129_27007_27561 168
121 3300050492 nmdc:mga0yw44_248322_c1 nmdc:mga0yw44_248322_c1_628_1137 168
122 3300050493 nmdc:mga0k408_32487_c1 nmdc:mga0k408_32487_c1_1781_2290 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

20

176

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kzk-assembly1.cif.gz_B crystal structure of rrna methyltransferase from sinorhizobium meliloti 0.9087 3 161
5l0z-assembly1.cif.gz_B crystal structure of adomet bound rrna methyltransferase from sinorhizobium meliloti 0.8925 1 161
1gz0-assembly4.cif.gz_D 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.8864 2 162
1v2x-assembly1.cif.gz_A-2 trmh 0.8788 1 162
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.8772 2 161
ID Description Score Start End Superfamily
af_Q0DW28_49_219_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9049 1 162 3.40.1280.10
af_Q22484_1055_1224_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9021 2 160 3.40.1280.10
af_A0A0G2JYA7_1418_1569_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8947 5 162 3.40.1280.10
af_Q07527_1273_1436_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8909 2 162 3.40.1280.10
af_P9WFY3_121_283_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8904 2 162 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A1F7QJ00-F1-model_v4 tRNA/rRNA methyltransferase SpoU type domain-containing protein 0.9729 1 163 GO:0000049
GO:0002938
GO:0008173
AF-A0A3S0DQC6-F1-model_v4 TrmH family RNA methyltransferase 0.9686 1 163 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A3G5T6T8-F1-model_v4 TrmH family RNA methyltransferase 0.9654 2 165 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A3D3HB42-F1-model_v4 TrmH family RNA methyltransferase 0.9626 2 164 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0016020
GO:0032259
AF-A0A521Z6Y6-F1-model_v4 TrmH family RNA methyltransferase 0.9624 1 161 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259

Feature Viewer

pLDDT pTM Quality
92.59 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map