F111220

General Info

Members Datasets Scaffolds Average Seq Length
121 86 111 270

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0065332|Ga0466965_0065332_474_1340
Length 288
Sequence MTHGTTSAPSVPHSGSEKAGRELLAGYVAVWWEAVNDFTDLLEELDEADWSAPTDLPGWDVKAVAAHVAHLEAILATGQEETAEVGQPDHVRSPMGLYTEIGVITRRDADPDAIINEIRAAATARHTALLADPPTDPTGRPDRTPGGVPWDWRTLLRNRPLDVWMHEQDVRRAVDRPGGMDSPAARHSAEYLAEGLGYVLAKRVGAPAGTTVVLEMEGSEPFAFEVADSGRGVRLDQPPAEPAVRLLMDREAFIRLAGGRCEPEPGTLRVEGDEELGRRILEALATTP

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221615 Nocardioides sp. Root224 Isolate Unclassified
3 2643221641 Nocardioides sp. Root122 Isolate Unclassified
4 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
5 2643221696 Nocardioides sp. Root140 Isolate Unclassified
6 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
7 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
8 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
9 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
26 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
27 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
28 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
29 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
30 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
31 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
32 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
33 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
34 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
35 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
36 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
37 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
38 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
39 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
40 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
41 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
42 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
43 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
44 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
45 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
46 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
47 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
48 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
49 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
50 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
51 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
52 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
53 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
54 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
58 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
65 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
66 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
67 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
68 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
69 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
70 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
71 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
72 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
73 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
76 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
77 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
78 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
79 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
80 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
81 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
82 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
83 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
84 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
85 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
86 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 0.83
Isolates 8.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.05
Nodule 0.83
Rhizoplane 10.74
Rhizosphere 65.29
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013286 3300001979 Bacteria 3078
2 Ga0070658_10081040 3300005327 Bacteria 2666
3 Ga0070659_100316054 3300005366 Bacteria 1305
4 Ga0070681_10639992 3300005458 Bacteria 978
5 Ga0070679_100006579 3300005530 Bacteria 10828
6 Ga0075365_10042607 3300006038 Bacteria 2968
7 Ga0075365_10311677 3300006038 Bacteria 1108
8 Ga0075363_100011575 3300006048 Bacteria 4229
9 Ga0075364_10016976 3300006051 Bacteria 4537
10 Ga0075364_10025604 3300006051 Bacteria 3756
11 Ga0075364_10096272 3300006051 Bacteria 1968
12 Ga0075370_10043476 3300006353 Bacteria 2539
13 Ga0157375_10140207 3300013308 Bacteria 2544
14 Ga0206353_11694820 3300020082 Bacteria 1456
15 Ga0207647_10004894 3300025904 Bacteria 9883
16 Ga0207705_10111593 3300025909 Bacteria 2021
17 Ga0207652_10003824 3300025921 Bacteria 12344
18 Ga0207674_10208195 3300026116 Bacteria 1905
19 Ga0307405_10176509 3300031731 Bacteria 1529
20 Ga0307405_10284904 3300031731 Bacteria 1246
21 Ga0307406_10411236 3300031901 Bacteria 1075
22 Ga0307409_100129299 3300031995 Bacteria 2155
23 Ga0307409_100169730 3300031995 Bacteria 1919
24 Ga0307409_100175211 3300031995 Bacteria 1892
25 Ga0307416_100146076 3300032002 Bacteria 2159
26 Ga0307411_10250569 3300032005 Bacteria 1392
27 Ga0307415_100060348 3300032126 Bacteria 2620
28 Ga0307415_100179829 3300032126 Bacteria 1658
29 Ga0395905_0363577 3300037471 Bacteria 1340
30 Ga0395901_0081190 3300038443 Bacteria 3387
31 Ga0451793_1447267 3300041452 Bacteria 1586
32 Ga0451841_0834684 3300041498 Bacteria 1015
33 Ga0466965_0043181 3300044683 Bacteria 2225
34 Ga0466965_0065332 3300044683 Bacteria 1823
35 Ga0466966_0046033 3300044684 Bacteria 2787
36 Ga0466963_0137723 3300044694 Bacteria 1690
37 Ga0466963_0142734 3300044694 Bacteria 1660
38 Ga0466963_0143690 3300044694 Bacteria 1654
39 Ga0466964_0027818 3300044706 Bacteria 2222
40 Ga0466971_0056646 3300044719 Bacteria 1768
41 Ga0466968_0006476 3300044735 Bacteria 4415
42 Ga0466970_0039600 3300044765 Bacteria 2501
43 Ga0466957_0051261 3300044842 Bacteria 2512
44 Ga0466957_0086802 3300044842 Bacteria 1955
45 Ga0466960_0002431 3300044901 Bacteria 7018
46 Ga0466960_0032059 3300044901 Bacteria 2429
47 Ga0466960_0055083 3300044901 Bacteria 1933
48 Ga0466967_0123918 3300045976 Bacteria 2392
49 Ga0495658_0144007 3300046683 Bacteria 1459
50 Ga0496101_0142004 3300048904 Bacteria 1831
51 Ga0496102_0267578 3300048905 Bacteria 1611
52 Ga0496107_0083557 3300048910 Bacteria 2328
53 Ga0496108_0115537 3300048911 Bacteria 2298
54 Ga0496109_0032370 3300048912 Bacteria 4700
55 Ga0496109_0311949 3300048912 Bacteria 1484
56 Ga0496109_0336633 3300048912 Bacteria 1425
57 Ga0496113_0022208 3300048916 Bacteria 4485
58 Ga0496114_0039889 3300048917 Bacteria 3886
59 Ga0496114_0185240 3300048917 Bacteria 1819
60 Ga0496114_0221499 3300048917 Bacteria 1661
61 Ga0496114_0319109 3300048917 Bacteria 1372
62 Ga0496124_0031827 3300048927 Bacteria 4665
63 Ga0501031_0006878 3300049568 Bacteria 7423
64 Ga0501031_0046465 3300049568 Bacteria 2831
65 Ga0501031_0266339 3300049568 Bacteria 1113
66 Ga0501036_0017101 3300049572 Bacteria 6061
67 Ga0501036_0191035 3300049572 Bacteria 1723
68 Ga0501036_0447719 3300049572 Bacteria 1076
69 Ga0501037_0046130 3300049573 Bacteria 3197
70 Ga0501038_0022364 3300049574 Bacteria 5668
71 Ga0501039_0043770 3300049575 Bacteria 3458
72 Ga0501040_0004913 3300049576 Bacteria 8653
73 Ga0501040_0304632 3300049576 Bacteria 1139
74 Ga0501041_0006132 3300049577 Bacteria 7029
75 Ga0501041_0046094 3300049577 Bacteria 2652
76 Ga0501042_0002477 3300049578 Bacteria 11345
77 Ga0501042_0121556 3300049578 Bacteria 1880
78 Ga0501046_0213329 3300049580 Bacteria 1432
79 Ga0501046_0346948 3300049580 Bacteria 1078
80 Ga0501048_0011708 3300049582 Bacteria 6543
81 Ga0501048_0280953 3300049582 Bacteria 1184
82 Ga0501071_0015659 3300049587 Bacteria 5206
83 Ga0501071_0035671 3300049587 Bacteria 3544
84 Ga0501072_0020717 3300049588 Bacteria 5096
85 Ga0501074_0013710 3300049590 Bacteria 5892
86 Ga0501075_0159256 3300049591 Bacteria 1722
87 Ga0501076_0010192 3300049592 Bacteria 6964
88 Ga0501076_0016873 3300049592 Bacteria 5545
89 Ga0501079_0057667 3300049741 Bacteria 2996
90 Ga0501079_0223046 3300049741 Bacteria 1473
91 Ga0501080_0128093 3300049742 Bacteria 2350
92 Ga0501080_0220970 3300049742 Bacteria 1734
93 Ga0501081_0055685 3300049743 Bacteria 2732
94 Ga0501083_0174860 3300049744 Bacteria 1403
95 Ga0501035_0266992 3300049822 Bacteria 1449
96 Ga0501044_0579733 3300049823 Bacteria 1016
97 Ga0501045_0068415 3300049824 Bacteria 2609
98 Ga0501045_0378060 3300049824 Bacteria 1054
99 nmdc:mga03n38_96682_c1 3300050490 Bacteria 1417
100 nmdc:mga00v17_307151_c1 3300050491 Bacteria 1030
101 nmdc:mga00v17_8270_c1 3300050491 Bacteria 5597
102 nmdc:mga00v17_98373_c1 3300050491 Bacteria 1845
103 nmdc:mga0yw44_2942_c1 3300050492 Bacteria 7416
104 nmdc:mga0yw44_30394_c1 3300050492 Bacteria 3129
105 Ga0495619_0135443 3300053085 Bacteria 1694
106 Ga0500644_0000056 3300053088 Bacteria 67323
107 Ga0500556_0002560 3300053104 Bacteria 5745
108 Ga0500593_000626 3300053117 Bacteria 13569
109 Ga0500573_0089700 3300053140 Bacteria 1738
110 Ga0501084_0012378 3300054114 Bacteria 7070
111 Ga0501082_0091393 3300060353 Bacteria 2628

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10208195 Ga0207674_102081952 227
2 3300031731 Ga0307405_10284904 Ga0307405_102849041 243
3 3300048917 Ga0496114_0039889 Ga0496114_0039889_2352_3164 245
4 3300006051 Ga0075364_10016976 Ga0075364_100169763 246
5 3300050491 nmdc:mga00v17_8270_c1 nmdc:mga00v17_8270_c1_3475_4290 246
6 3300050492 nmdc:mga0yw44_2942_c1 nmdc:mga0yw44_2942_c1_4277_5092 246
7 3300049582 Ga0501048_0280953 Ga0501048_0280953_19_834 247
8 3300006051 Ga0075364_10025604 Ga0075364_100256041 248
9 3300031995 Ga0307409_100169730 Ga0307409_1001697302 248
10 3300037471 Ga0395905_0363577 Ga0395905_0363577_98_913 249
11 3300044719 Ga0466971_0056646 Ga0466971_0056646_564_1430 252
12 3300005366 Ga0070659_100316054 Ga0070659_1003160542 257
13 3300048912 Ga0496109_0311949 Ga0496109_0311949_286_1110 261
14 3300048917 Ga0496114_0185240 Ga0496114_0185240_591_1415 261
15 3300049572 Ga0501036_0447719 Ga0501036_0447719_198_1061 263
16 iso_pu_bacteria 2643221561 2643826792 264
17 iso_pu_bacteria 2643221696 2644534145 264
18 iso_pu_bacteria 8054609563 8054612183 264
19 iso_pu_bacteria 2808606439 2809194099 265
20 iso_pu_bacteria 2891968417 2891973408 265
21 3300044694 Ga0466963_0137723 Ga0466963_0137723_534_1367 266
22 3300044694 Ga0466963_0142734 Ga0466963_0142734_66_923 266
23 3300044735 Ga0466968_0006476 Ga0466968_0006476_1788_2597 266
24 3300038443 Ga0395901_0081190 Ga0395901_0081190_2366_3175 267
25 3300048912 Ga0496109_0336633 Ga0496109_0336633_164_973 267
26 3300048917 Ga0496114_0221499 Ga0496114_0221499_193_1002 267
27 3300049568 Ga0501031_0006878 Ga0501031_0006878_2890_3699 267
28 3300049572 Ga0501036_0017101 Ga0501036_0017101_3498_4307 267
29 3300049573 Ga0501037_0046130 Ga0501037_0046130_259_1068 267
30 3300049574 Ga0501038_0022364 Ga0501038_0022364_188_997 267
31 3300049576 Ga0501040_0004913 Ga0501040_0004913_926_1735 267
32 3300049577 Ga0501041_0006132 Ga0501041_0006132_533_1342 267
33 3300049578 Ga0501042_0002477 Ga0501042_0002477_67_876 267
34 3300049580 Ga0501046_0346948 Ga0501046_0346948_146_955 267
35 3300049582 Ga0501048_0011708 Ga0501048_0011708_5670_6479 267
36 3300049587 Ga0501071_0015659 Ga0501071_0015659_4364_5173 267
37 3300049588 Ga0501072_0020717 Ga0501072_0020717_1783_2592 267
38 3300049590 Ga0501074_0013710 Ga0501074_0013710_1671_2480 267
39 3300049591 Ga0501075_0159256 Ga0501075_0159256_766_1575 267
40 3300049592 Ga0501076_0010192 Ga0501076_0010192_2008_2817 267
41 3300049741 Ga0501079_0057667 Ga0501079_0057667_1803_2612 267
42 3300049742 Ga0501080_0128093 Ga0501080_0128093_1128_1937 267
43 3300049743 Ga0501081_0055685 Ga0501081_0055685_48_857 267
44 3300049744 Ga0501083_0174860 Ga0501083_0174860_36_845 267
45 3300049822 Ga0501035_0266992 Ga0501035_0266992_382_1191 267
46 3300049823 Ga0501044_0579733 Ga0501044_0579733_149_958 267
47 3300054114 Ga0501084_0012378 Ga0501084_0012378_932_1741 267
48 3300060353 Ga0501082_0091393 Ga0501082_0091393_728_1537 267
49 3300031995 Ga0307409_100129299 Ga0307409_1001292992 268
50 3300041498 Ga0451841_0834684 Ga0451841_0834684_18_839 268
51 3300044683 Ga0466965_0043181 Ga0466965_0043181_387_1295 268
52 3300044901 Ga0466960_0032059 Ga0466960_0032059_168_1076 268
53 3300045976 Ga0466967_0123918 Ga0466967_0123918_499_1311 268
54 3300049742 Ga0501080_0220970 Ga0501080_0220970_594_1409 268
55 3300001979 JGI24740J21852_10013286 JGI24740J21852_100132863 269
56 3300005327 Ga0070658_10081040 Ga0070658_100810403 269
57 3300005458 Ga0070681_10639992 Ga0070681_106399921 269
58 3300005530 Ga0070679_100006579 Ga0070679_1000065799 269
59 3300006038 Ga0075365_10042607 Ga0075365_100426072 269
60 3300006038 Ga0075365_10311677 Ga0075365_103116772 269
61 3300006048 Ga0075363_100011575 Ga0075363_1000115753 269
62 3300006051 Ga0075364_10096272 Ga0075364_100962723 269
63 3300006353 Ga0075370_10043476 Ga0075370_100434763 269
64 3300013308 Ga0157375_10140207 Ga0157375_101402071 269
65 3300020082 Ga0206353_11694820 Ga0206353_116948202 269
66 3300025904 Ga0207647_10004894 Ga0207647_100048945 269
67 3300025909 Ga0207705_10111593 Ga0207705_101115932 269
68 3300025921 Ga0207652_10003824 Ga0207652_100038246 269
69 3300031731 Ga0307405_10176509 Ga0307405_101765092 269
70 3300031901 Ga0307406_10411236 Ga0307406_104112362 269
71 3300031995 Ga0307409_100175211 Ga0307409_1001752112 269
72 3300032002 Ga0307416_100146076 Ga0307416_1001460762 269
73 3300032005 Ga0307411_10250569 Ga0307411_102505692 269
74 3300032126 Ga0307415_100060348 Ga0307415_1000603482 269
75 3300032126 Ga0307415_100179829 Ga0307415_1001798292 269
76 3300041452 Ga0451793_1447267 Ga0451793_1447267_110_928 269
77 3300044683 Ga0466965_0065332 Ga0466965_0065332_474_1340 269
78 3300044684 Ga0466966_0046033 Ga0466966_0046033_424_1290 269
79 3300044694 Ga0466963_0143690 Ga0466963_0143690_288_1154 269
80 3300044706 Ga0466964_0027818 Ga0466964_0027818_1047_1913 269
81 3300044765 Ga0466970_0039600 Ga0466970_0039600_441_1331 269
82 3300044842 Ga0466957_0051261 Ga0466957_0051261_1047_1913 269
83 3300044842 Ga0466957_0086802 Ga0466957_0086802_753_1619 269
84 3300044901 Ga0466960_0002431 Ga0466960_0002431_1076_1891 269
85 3300044901 Ga0466960_0055083 Ga0466960_0055083_987_1901 269
86 3300046683 Ga0495658_0144007 Ga0495658_0144007_567_1382 269
87 3300048904 Ga0496101_0142004 Ga0496101_0142004_501_1316 269
88 3300048905 Ga0496102_0267578 Ga0496102_0267578_112_927 269
89 3300048910 Ga0496107_0083557 Ga0496107_0083557_455_1270 269
90 3300048911 Ga0496108_0115537 Ga0496108_0115537_1392_2207 269
91 3300048912 Ga0496109_0032370 Ga0496109_0032370_2596_3411 269
92 3300048916 Ga0496113_0022208 Ga0496113_0022208_1168_1983 269
93 3300048917 Ga0496114_0319109 Ga0496114_0319109_93_908 269
94 3300048927 Ga0496124_0031827 Ga0496124_0031827_3565_4404 269
95 3300049568 Ga0501031_0046465 Ga0501031_0046465_320_1135 269
96 3300049568 Ga0501031_0266339 Ga0501031_0266339_88_912 269
97 3300049572 Ga0501036_0191035 Ga0501036_0191035_249_1064 269
98 3300049575 Ga0501039_0043770 Ga0501039_0043770_1703_2527 269
99 3300049576 Ga0501040_0304632 Ga0501040_0304632_262_1095 269
100 3300049577 Ga0501041_0046094 Ga0501041_0046094_623_1438 269
101 3300049578 Ga0501042_0121556 Ga0501042_0121556_260_1084 269
102 3300049580 Ga0501046_0213329 Ga0501046_0213329_143_967 269
103 3300049587 Ga0501071_0035671 Ga0501071_0035671_2700_3524 269
104 3300049592 Ga0501076_0016873 Ga0501076_0016873_2222_3046 269
105 3300049741 Ga0501079_0223046 Ga0501079_0223046_69_884 269
106 3300049824 Ga0501045_0068415 Ga0501045_0068415_1602_2417 269
107 3300049824 Ga0501045_0378060 Ga0501045_0378060_140_964 269
108 3300050490 nmdc:mga03n38_96682_c1 nmdc:mga03n38_96682_c1_479_1294 269
109 3300050491 nmdc:mga00v17_307151_c1 nmdc:mga00v17_307151_c1_76_900 269
110 3300050491 nmdc:mga00v17_98373_c1 nmdc:mga00v17_98373_c1_49_864 269
111 3300050492 nmdc:mga0yw44_30394_c1 nmdc:mga0yw44_30394_c1_893_1738 269
112 3300053085 Ga0495619_0135443 Ga0495619_0135443_302_1117 269
113 3300053088 Ga0500644_0000056 Ga0500644_0000056_60599_61414 269
114 3300053104 Ga0500556_0002560 Ga0500556_0002560_1779_2594 269
115 3300053117 Ga0500593_000626 Ga0500593_000626_1765_2580 269
116 3300053140 Ga0500573_0089700 Ga0500573_0089700_228_1040 269
117 iso_pu_bacteria 2643221615 2644092825 269
118 iso_pu_bacteria 2643221641 2644228198 269
119 iso_pu_bacteria 2643221657 2644322438 269
120 iso_pu_bacteria 2773857762 2774395070 269
121 iso_pu_bacteria 2811994878 2812348828 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11716

MDMPI_N

Mycothiol maleylpyruvate isomerase N-terminal domain

31

171

0.96

PF07398

MDMPI_C

MDMPI C-terminal domain

186

279

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bn8-assembly1.cif.gz_A-2 crystal structure of a putative sterol carrier protein type 2 (af1534) from archaeoglobus fulgidus dsm 4304 at 2.11 a resolution 0.7726 172 253
3bn8-assembly2.cif.gz_B-2 crystal structure of a putative sterol carrier protein type 2 (af1534) from archaeoglobus fulgidus dsm 4304 at 2.11 a resolution 0.7155 172 258
3cnu-assembly1.cif.gz_A-2 crystal structure of the predicted coding region af_1534 from archaeoglobus fulgidus 0.7125 172 258
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.6958 8 159
1c44-assembly1.cif.gz_A sterol carrier protein 2 (scp2) from rabbit 0.6883 172 266
ID Description Score Start End Superfamily
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8703 7 157 1.20.120.450
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8441 7 157 1.20.120.450
af_O05777_178_274_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8048 166 258 3.30.1050.10
af_P64599_56_138_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.7969 194 268 3.30.1050.10
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7855 13 156 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2E2Q0G8-F1-model_v4 Maleylpyruvate isomerase family mycothiol-dependent enzyme 0.9854 1 269 GO:0046872
AF-A0A2E2Q0G8-F1-model_v4 Maleylpyruvate isomerase family mycothiol-dependent enzyme 0.9818 1 269 GO:0046872
AF-A0A7G9RF83-F1-model_v4 Maleylpyruvate isomerase family mycothiol-dependent enzyme 0.9644 1 269 GO:0016853
GO:0046872
AF-A0A7G9RF83-F1-model_v4 Maleylpyruvate isomerase family mycothiol-dependent enzyme 0.9609 1 269 GO:0016853
GO:0046872
AF-A0A7J9VUW7-F1-model_v4 Maleylpyruvate isomerase family mycothiol-dependent enzyme 0.9596 10 269 GO:0016853
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.95 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map