F110977

General Info

Members Datasets Scaffolds Average Seq Length
121 37 242 182

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0771722|Ga0316582_0771722_25_648
Length 207
Sequence MDRRADEQGLSNRSVEGLTMATTNGLYEEIVIAGFGGQGIILVGKLLAQTAMKAGLEVTYMPSYGAEVRGGTANCTVIVSDRPIACPVLSEPESLIAMNKASLHKFGPRLKPGGLLLWNSSLIESTPEVDESVERVAIAADEVAVELGSPKSANMVMLGAYLRKRGHLSPDQAAEALRDVLAERYHKTIAVNTEALRRGAEFAVCHA

Samples

Sample ID Description Type Environment
1 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
4 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
5 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
6 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
7 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
8 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
9 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
10 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
11 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
12 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
13 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
14 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
15 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
16 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
17 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
18 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
19 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
20 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
21 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
22 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
23 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
24 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
25 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
26 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
27 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
28 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
29 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
30 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
31 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
32 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
33 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
34 2738541295 Bacillus sp. OK085 Isolate Unclassified
35 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
36 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
37 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0
Isolates 3.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.48
Rhizosphere 90.08
Stem 0
Stem Tuber 0
Unclassified 10.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316582_0771722 3300036647 Unclassified 659
2 Ga0065704_10117617 3300005289 Bacteria 1831
3 Ga0265323_10028066 3300028653 Bacteria 2111
4 Ga0265322_10012193 3300028654 Bacteria 2486
5 Ga0265322_10023480 3300028654 Bacteria 1763
6 Ga0265338_10103828 3300028800 Bacteria 2307
7 Ga0265330_10006646 3300031235 Bacteria 5705
8 Ga0265332_10001396 3300031238 Bacteria 13607
9 Ga0265332_10196820 3300031238 Bacteria 838
10 Ga0265328_10125213 3300031239 Bacteria 960
11 Ga0265329_10041153 3300031242 Bacteria 1483
12 Ga0265329_10074825 3300031242 Bacteria 1071
13 Ga0265339_10009085 3300031249 Bacteria 6280
14 Ga0265316_10000021 3300031344 Bacteria 185946
15 Ga0265316_10000146 3300031344 Bacteria 77550
16 Ga0265316_10000304 3300031344 Bacteria 55168
17 Ga0265316_10001022 3300031344 Bacteria 30358
18 Ga0265316_10074827 3300031344 Bacteria 2605
19 Ga0265316_10479291 3300031344 Bacteria 890
20 Ga0316575_10005819 3300031665 Bacteria 4407
21 Ga0316579_10003519 3300031691 Bacteria 6125
22 Ga0316579_10011252 3300031691 Bacteria 3799
23 Ga0316579_10253718 3300031691 Unclassified 851
24 Ga0265342_10000714 3300031712 Bacteria 34315
25 Ga0265342_10013999 3300031712 Bacteria 5342
26 Ga0265342_10321038 3300031712 Bacteria 812
27 Ga0316576_10008217 3300031727 Bacteria 6636
28 Ga0316576_10087017 3300031727 Unclassified 2325
29 Ga0316576_10147456 3300031727 Bacteria 1773
30 Ga0316576_10212687 3300031727 Bacteria 1455
31 Ga0316576_10215483 3300031727 Bacteria 1445
32 Ga0316576_10251806 3300031727 Bacteria 1326
33 Ga0316578_10020439 3300031728 Bacteria 3658
34 Ga0316577_10062731 3300031733 Bacteria 2075
35 Ga0316577_10119105 3300031733 Bacteria 1483
36 Ga0316577_10230669 3300031733 Bacteria 1047
37 Ga0307409_101273414 3300031995 Bacteria 760
38 Ga0316583_10005872 3300032133 Unclassified 4416
39 Ga0316585_10261407 3300032137 Bacteria 574
40 Ga0316574_0005604 3300035398 Bacteria 6709
41 Ga0316574_0199057 3300035398 Bacteria 1287
42 Ga0316574_0422462 3300035398 Bacteria 837
43 Ga0316582_0001099 3300036647 Bacteria 11406
44 Ga0316582_0001855 3300036647 Bacteria 9579
45 Ga0316582_0047980 3300036647 Unclassified 2698
46 Ga0316582_0049159 3300036647 Bacteria 2668
47 Ga0316582_0129265 3300036647 Bacteria 1695
48 Ga0316582_0138663 3300036647 Bacteria 1639
49 Ga0316582_0210349 3300036647 Bacteria 1329
50 Ga0316582_0351190 3300036647 Bacteria 1014
51 Ga0316582_0645396 3300036647 Bacteria 728
52 Ga0316582_0653100 3300036647 Bacteria 723
53 Ga0316582_0794311 3300036647 Bacteria 649
54 Ga0316584_0025874 3300036712 Unclassified 4307
55 Ga0316584_0033284 3300036712 Bacteria 3818
56 Ga0316584_0116239 3300036712 Bacteria 2001
57 Ga0316584_0144784 3300036712 Bacteria 1770
58 Ga0316584_0179926 3300036712 Bacteria 1566
59 Ga0316584_0272119 3300036712 Bacteria 1233
60 Ga0316581_0033532 3300037588 Bacteria 1551
61 Ga0316581_0122260 3300037588 Bacteria 802
62 Ga0400490_09629 3300038726 Bacteria 62048
63 Ga0400489_22091 3300039093 Bacteria 1178
64 Ga0400489_32228 3300039093 Bacteria 31367
65 Ga0400489_44684 3300039093 Bacteria 12976
66 Ga0400489_62094 3300039093 Bacteria 23711
67 Ga0400489_75613 3300039093 Bacteria 1000
68 Ga0400489_77377 3300039093 Bacteria 8203
69 Ga0451795_0685601 3300041456 Bacteria 785
70 Ga0451577_0003210 3300042876 Bacteria 18374
71 Ga0451577_0010305 3300042876 Bacteria 8947
72 Ga0451577_0013702 3300042876 Bacteria 7579
73 Ga0451577_0024629 3300042876 Bacteria 5473
74 Ga0451577_0032929 3300042876 Bacteria 4672
75 Ga0451577_0053781 3300042876 Bacteria 3594
76 Ga0451577_0081849 3300042876 Bacteria 2880
77 Ga0451577_0214035 3300042876 Bacteria 1741
78 Ga0451577_0216343 3300042876 Bacteria 1731
79 Ga0451577_0219203 3300042876 Bacteria 1719
80 Ga0451577_0332586 3300042876 Bacteria 1378
81 Ga0451577_0350774 3300042876 Bacteria 1339
82 Ga0451577_0366535 3300042876 Bacteria 1307
83 Ga0451577_0393420 3300042876 Bacteria 1258
84 Ga0451577_0413625 3300042876 Unclassified 1224
85 Ga0451577_1177435 3300042876 Unclassified 684
86 Ga0453684_0000689 3300044712 Bacteria 120254
87 Ga0453684_0001030 3300044712 Bacteria 89069
88 Ga0453684_0001369 3300044712 Bacteria 70779
89 Ga0453684_0001386 3300044712 Bacteria 70120
90 Ga0453684_0002132 3300044712 Bacteria 49698
91 Ga0453684_0006790 3300044712 Bacteria 21529
92 Ga0453684_0007056 3300044712 Bacteria 20991
93 Ga0453684_0008497 3300044712 Bacteria 18358
94 Ga0453684_0011997 3300044712 Bacteria 14411
95 Ga0453684_0014806 3300044712 Bacteria 12424
96 Ga0453684_0024746 3300044712 Bacteria 8753
97 Ga0453684_0024813 3300044712 Bacteria 8739
98 Ga0453684_0063241 3300044712 Bacteria 4735
99 Ga0453684_0111177 3300044712 Bacteria 3329
100 Ga0453684_0143924 3300044712 Bacteria 2842
101 Ga0453684_0161897 3300044712 Bacteria 2646
102 Ga0453684_0311505 3300044712 Bacteria 1786
103 Ga0453684_0349586 3300044712 Bacteria 1667
104 Ga0453684_0503338 3300044712 Bacteria 1341
105 Ga0453684_0654408 3300044712 Unclassified 1146
106 Ga0453684_0704957 3300044712 Bacteria 1096
107 Ga0453684_0796507 3300044712 Bacteria 1019
108 Ga0453684_1688927 3300044712 Bacteria 647
109 Ga0453684_1781808 3300044712 Bacteria 626
110 Ga0451576_0752824 3300045051 Unclassified 1023
111 Ga0451576_0773239 3300045051 Unclassified 1008
112 Ga0451576_0991653 3300045051 Bacteria 880
113 Ga0496112_0367284 3300048915 Unclassified 1381
114 Ga0496112_0634051 3300048915 Bacteria 999
115 Ga0501292_054643 3300049515 Unclassified 714
116 Ga0501076_0894760 3300049592 Bacteria 732
117 Ga0501084_0619986 3300054114 Bacteria 914
118 2738812469 2738541295 Bacteria 5730091
119 2964377142 2964375228 Bacteria 4909004
120 2990279919 2990275345 Bacteria 4887158
121 3001893958 3001892409 Bacteria 6328293
122 Ga0316582_0771722
123 Ga0065704_10117617
124 Ga0265323_10028066
125 Ga0265322_10012193
126 Ga0265322_10023480
127 Ga0265338_10103828
128 Ga0265330_10006646
129 Ga0265332_10001396
130 Ga0265332_10196820
131 Ga0265328_10125213
132 Ga0265329_10041153
133 Ga0265329_10074825
134 Ga0265339_10009085
135 Ga0265316_10000021
136 Ga0265316_10000146
137 Ga0265316_10000304
138 Ga0265316_10001022
139 Ga0265316_10074827
140 Ga0265316_10479291
141 Ga0316575_10005819
142 Ga0316579_10003519
143 Ga0316579_10011252
144 Ga0316579_10253718
145 Ga0265342_10000714
146 Ga0265342_10013999
147 Ga0265342_10321038
148 Ga0316576_10008217
149 Ga0316576_10087017
150 Ga0316576_10147456
151 Ga0316576_10212687
152 Ga0316576_10215483
153 Ga0316576_10251806
154 Ga0316578_10020439
155 Ga0316577_10062731
156 Ga0316577_10119105
157 Ga0316577_10230669
158 Ga0307409_101273414
159 Ga0316583_10005872
160 Ga0316585_10261407
161 Ga0316574_0005604
162 Ga0316574_0199057
163 Ga0316574_0422462
164 Ga0316582_0001099
165 Ga0316582_0001855
166 Ga0316582_0047980
167 Ga0316582_0049159
168 Ga0316582_0129265
169 Ga0316582_0138663
170 Ga0316582_0210349
171 Ga0316582_0351190
172 Ga0316582_0645396
173 Ga0316582_0653100
174 Ga0316582_0794311
175 Ga0316584_0025874
176 Ga0316584_0033284
177 Ga0316584_0116239
178 Ga0316584_0144784
179 Ga0316584_0179926
180 Ga0316584_0272119
181 Ga0316581_0033532
182 Ga0316581_0122260
183 Ga0400490_09629
184 Ga0400489_22091
185 Ga0400489_32228
186 Ga0400489_44684
187 Ga0400489_62094
188 Ga0400489_75613
189 Ga0400489_77377
190 Ga0451795_0685601
191 Ga0451577_0003210
192 Ga0451577_0010305
193 Ga0451577_0013702
194 Ga0451577_0024629
195 Ga0451577_0032929
196 Ga0451577_0053781
197 Ga0451577_0081849
198 Ga0451577_0214035
199 Ga0451577_0216343
200 Ga0451577_0219203
201 Ga0451577_0332586
202 Ga0451577_0350774
203 Ga0451577_0366535
204 Ga0451577_0393420
205 Ga0451577_0413625
206 Ga0451577_1177435
207 Ga0453684_0000689
208 Ga0453684_0001030
209 Ga0453684_0001369
210 Ga0453684_0001386
211 Ga0453684_0002132
212 Ga0453684_0006790
213 Ga0453684_0007056
214 Ga0453684_0008497
215 Ga0453684_0011997
216 Ga0453684_0014806
217 Ga0453684_0024746
218 Ga0453684_0024813
219 Ga0453684_0063241
220 Ga0453684_0111177
221 Ga0453684_0143924
222 Ga0453684_0161897
223 Ga0453684_0311505
224 Ga0453684_0349586
225 Ga0453684_0503338
226 Ga0453684_0654408
227 Ga0453684_0704957
228 Ga0453684_0796507
229 Ga0453684_1688927
230 Ga0453684_1781808
231 Ga0451576_0752824
232 Ga0451576_0773239
233 Ga0451576_0991653
234 Ga0496112_0367284
235 Ga0496112_0634051
236 Ga0501292_054643
237 Ga0501076_0894760
238 Ga0501084_0619986
239 2738812469
240 2964377142
241 2990279919
242 3001893958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01558

POR

Pyruvate ferredoxin/flavodoxin oxidoreductase

36

201

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3on3-assembly2.cif.gz_A the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.9112 3 175
3on3-assembly2.cif.gz_A the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.8959 3 175
3on3-assembly3.cif.gz_B the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.8941 1 175
3g2e-assembly1.cif.gz_D structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni 0.8712 1 175
3on3-assembly3.cif.gz_B the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.8701 1 175
ID Description Score Start End Superfamily
3on3A00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.9101 3 175 3.40.920.10
3on3A00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8946 3 175 3.40.920.10
af_Q2FZ05_1_182_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8668 2 179 3.40.920.10
af_Q57717_1_177_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8656 3 176 3.40.920.10
3g2eC00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8579 1 176 3.40.920.10
ID Description Score Start End GO Terms
AF-A0A7X6NQU2-F1-model_v4 deleted 0.9493 1 128
AF-A0A2N1PT78-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit gamma 0.9479 1 176 GO:0016903
AF-A0A4V1S3W7-F1-model_v4 deleted 0.9478 1 179
AF-A0A7X6X4B2-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit gamma 0.947 1 144 GO:0016903
AF-Q3AEK3-F1-model_v4 Putative keto/oxoacid ferredoxin oxidoreductase, gamma subunit 0.9449 4 175 GO:0016625

Map