F110722

General Info

Members Datasets Scaffolds Average Seq Length
121 73 242 360

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10005166|Ga0265316_1000516611
Length 395
Sequence MSVSRRSFFARAGAIAAAQGLALNAQQTPAPPSKAPRPGSSYDPRTGTADATKEFVFYDRRSKVSLIKGENRRKNIYDALMAIDDQIRPALRARKYVFVKINGVDPITRQLGSTSPDALRGVLDYLAPHFKGPVVVGDSSDFPAKRTVSEYGWDKVFGEYKSLNLAFEVPNEECRHGLMYGMDYDMHVIPIQLGARFLDPDAFVMSLSVMKTHNMVVATMSVKNVVMGAPLAVPIGSNITWQQCEKRRFHVGIRAGNYNMFLAAQRMISNWGVGIVDGFEGMEGNGPAQGTPLTPPHRIAVASTDFLAADRVSLECMGIDATWPGYLNYASQCGLGQFNLSKIDVLGAKIADVKRKYRLHADVDRMLEWRGPMLDLPPNLGRNRPPREEDRNPYA

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
27 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
36 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
37 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
38 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
39 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
40 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
41 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
42 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
43 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
44 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
45 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
46 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
47 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
48 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
49 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
50 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
51 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
52 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
53 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
54 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
55 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
56 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
57 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
58 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
59 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
60 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
61 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
62 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
63 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
64 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
65 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
66 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
67 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
68 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
69 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
70 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
71 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
72 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
73 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.83
Rhizosphere 98.35
Stem 0
Stem Tuber 0
Unclassified 33.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10005166 3300031344 Bacteria 12783
2 rootH1_10276637 3300003323 Unclassified 1757
3 Ga0070683_100000039 3300005329 Bacteria 119209
4 Ga0070670_100274264 3300005331 Bacteria 1472
5 Ga0070714_100004731 3300005435 Bacteria 10302
6 Ga0070714_100478657 3300005435 Bacteria 1185
7 Ga0070713_100006427 3300005436 Bacteria 8147
8 Ga0070713_100130347 3300005436 Bacteria 2216
9 Ga0070713_100171554 3300005436 Unclassified 1943
10 Ga0070713_100176949 3300005436 Unclassified 1915
11 Ga0070684_100000027 3300005535 Bacteria 119209
12 Ga0068853_100191499 3300005539 Unclassified 1858
13 Ga0070665_100427244 3300005548 Unclassified 1334
14 Ga0068855_100082020 3300005563 Unclassified 3738
15 Ga0068855_100138028 3300005563 Bacteria 2781
16 Ga0068855_100296123 3300005563 Bacteria 1793
17 Ga0068856_100054776 3300005614 Bacteria 3935
18 Ga0068856_100122950 3300005614 Bacteria 2598
19 Ga0068852_100249834 3300005616 Bacteria 1699
20 Ga0097621_100142062 3300006237 Bacteria 2052
21 Ga0105240_10044046 3300009093 Bacteria 5674
22 Ga0105240_10090140 3300009093 Bacteria 3749
23 Ga0105240_10283088 3300009093 Bacteria 1904
24 Ga0105245_10526184 3300009098 Unclassified 1202
25 Ga0105241_10067645 3300009174 Bacteria 2765
26 Ga0105248_10222140 3300009177 Unclassified 2127
27 Ga0105248_10278496 3300009177 Unclassified 1883
28 Ga0105237_10043175 3300009545 Unclassified 4543
29 Ga0157373_10118667 3300013100 Bacteria 1859
30 Ga0157369_10057369 3300013105 Bacteria 4201
31 Ga0157369_10113389 3300013105 Bacteria 2880
32 Ga0157369_10276854 3300013105 Unclassified 1748
33 Ga0157374_10002690 3300013296 Bacteria 14949
34 Ga0163162_10371537 3300013306 Bacteria 1563
35 Ga0157372_10005454 3300013307 Bacteria 13518
36 Ga0157372_10040879 3300013307 Bacteria 5124
37 Ga0157372_10053986 3300013307 Unclassified 4480
38 Ga0157372_10268265 3300013307 Bacteria 1983
39 Ga0157375_10048160 3300013308 Unclassified 4168
40 Ga0163163_10071843 3300014325 Bacteria 3449
41 Ga0163163_10201489 3300014325 Unclassified 2038
42 Ga0163163_10207147 3300014325 Bacteria 2010
43 Ga0157376_10103982 3300014969 Bacteria 2488
44 Ga0157376_10334411 3300014969 Bacteria 1444
45 Ga0207695_10023465 3300025913 Bacteria 6969
46 Ga0207695_10221089 3300025913 Unclassified 1801
47 Ga0207671_10036266 3300025914 Bacteria 3657
48 Ga0207700_10085285 3300025928 Bacteria 2479
49 Ga0207664_10005730 3300025929 Bacteria 8495
50 Ga0207664_10022312 3300025929 Bacteria 4724
51 Ga0207661_10000043 3300025944 Bacteria 119208
52 Ga0207667_10040401 3300025949 Bacteria 4968
53 Ga0207667_10146977 3300025949 Bacteria 2426
54 Ga0207641_10017735 3300026088 Bacteria 5832
55 Ga0207683_10240649 3300026121 Unclassified 1651
56 Ga0265323_10001769 3300028653 Bacteria 10255
57 Ga0265323_10005345 3300028653 Bacteria 5460
58 Ga0265325_10115255 3300031241 Unclassified 1301
59 Ga0265340_10048211 3300031247 Bacteria 2072
60 Ga0265316_10000808 3300031344 Bacteria 34571
61 Ga0265316_10002307 3300031344 Bacteria 19944
62 Ga0265316_10002688 3300031344 Bacteria 18302
63 Ga0265316_10005411 3300031344 Bacteria 12404
64 Ga0265316_10006875 3300031344 Bacteria 10796
65 Ga0265316_10009997 3300031344 Bacteria 8679
66 Ga0265316_10014035 3300031344 Bacteria 7076
67 Ga0265316_10014553 3300031344 Bacteria 6915
68 Ga0265316_10028984 3300031344 Bacteria 4558
69 Ga0265316_10031691 3300031344 Unclassified 4319
70 Ga0265316_10040419 3300031344 Bacteria 3738
71 Ga0265316_10043447 3300031344 Bacteria 3581
72 Ga0265316_10054779 3300031344 Unclassified 3122
73 Ga0265316_10059795 3300031344 Unclassified 2963
74 Ga0265316_10079822 3300031344 Unclassified 2510
75 Ga0265316_10122263 3300031344 Unclassified 1965
76 Ga0265314_10021345 3300031711 Bacteria 4980
77 Ga0265342_10027323 3300031712 Unclassified 3568
78 Ga0265342_10028880 3300031712 Unclassified 3449
79 Ga0265342_10106067 3300031712 Bacteria 1595
80 Ga0316576_10075348 3300031727 Bacteria 2496
81 Ga0316577_10000250 3300031733 Bacteria 18925
82 Ga0373937_0201511 3300036401 Unclassified 1871
83 Ga0316582_0188328 3300036647 Bacteria 1405
84 Ga0316584_0002048 3300036712 Bacteria 12618
85 Ga0373925_0106266 3300037068 Bacteria 2164
86 Ga0395898_0086438 3300037466 Bacteria 3022
87 Ga0466966_0106124 3300044684 Unclassified 1734
88 Ga0466963_0111908 3300044694 Bacteria 1875
89 Ga0453684_0040531 3300044712 Bacteria 6322
90 Ga0453684_0214065 3300044712 Bacteria 2237
91 Ga0453684_0300631 3300044712 Unclassified 1824
92 Ga0451576_0542642 3300045051 Bacteria 1222
93 Ga0495651_0093138 3300046462 Unclassified 2256
94 Ga0495580_0050416 3300046472 Bacteria 2943
95 Ga0495580_0222263 3300046472 Unclassified 1298
96 Ga0495582_0154875 3300046473 Bacteria 1302
97 Ga0495662_0008957 3300046476 Unclassified 4915
98 Ga0495630_0029368 3300046517 Bacteria 4088
99 Ga0495652_0135637 3300046529 Unclassified 1942
100 Ga0495640_0061150 3300046533 Bacteria 2559
101 Ga0495587_0074642 3300046536 Bacteria 1969
102 Ga0495645_0026406 3300046543 Bacteria 4215
103 Ga0495645_0092953 3300046543 Unclassified 2153
104 Ga0495667_0026688 3300046559 Unclassified 3892
105 Ga0495635_0033100 3300046663 Unclassified 3586
106 Ga0495599_0204869 3300046678 Unclassified 1211
107 Ga0495623_0049531 3300046679 Bacteria 2662
108 Ga0495646_0029435 3300046680 Bacteria 3433
109 Ga0495613_0061776 3300046689 Bacteria 2743
110 Ga0495600_0042862 3300046809 Bacteria 2951
111 Ga0495604_0014126 3300047317 Bacteria 6368
112 Ga0495674_0014023 3300047319 Bacteria 7513
113 Ga0495674_0083539 3300047319 Bacteria 2737
114 Ga0495674_0125156 3300047319 Unclassified 2169
115 Ga0495680_0074224 3300047322 Unclassified 2583
116 Ga0495675_0038112 3300047444 Unclassified 3062
117 Ga0495684_0000364 3300047471 Bacteria 36846
118 Ga0495684_0047708 3300047471 Bacteria 3275
119 Ga0495602_0005811 3300048088 Bacteria 12950
120 Ga0495602_0285757 3300048088 Unclassified 1213
121 Ga0496109_0593726 3300048912 Unclassified 1043
122 Ga0265316_10005166
123 rootH1_10276637
124 Ga0070683_100000039
125 Ga0070670_100274264
126 Ga0070714_100004731
127 Ga0070714_100478657
128 Ga0070713_100006427
129 Ga0070713_100130347
130 Ga0070713_100171554
131 Ga0070713_100176949
132 Ga0070684_100000027
133 Ga0068853_100191499
134 Ga0070665_100427244
135 Ga0068855_100082020
136 Ga0068855_100138028
137 Ga0068855_100296123
138 Ga0068856_100054776
139 Ga0068856_100122950
140 Ga0068852_100249834
141 Ga0097621_100142062
142 Ga0105240_10044046
143 Ga0105240_10090140
144 Ga0105240_10283088
145 Ga0105245_10526184
146 Ga0105241_10067645
147 Ga0105248_10222140
148 Ga0105248_10278496
149 Ga0105237_10043175
150 Ga0157373_10118667
151 Ga0157369_10057369
152 Ga0157369_10113389
153 Ga0157369_10276854
154 Ga0157374_10002690
155 Ga0163162_10371537
156 Ga0157372_10005454
157 Ga0157372_10040879
158 Ga0157372_10053986
159 Ga0157372_10268265
160 Ga0157375_10048160
161 Ga0163163_10071843
162 Ga0163163_10201489
163 Ga0163163_10207147
164 Ga0157376_10103982
165 Ga0157376_10334411
166 Ga0207695_10023465
167 Ga0207695_10221089
168 Ga0207671_10036266
169 Ga0207700_10085285
170 Ga0207664_10005730
171 Ga0207664_10022312
172 Ga0207661_10000043
173 Ga0207667_10040401
174 Ga0207667_10146977
175 Ga0207641_10017735
176 Ga0207683_10240649
177 Ga0265323_10001769
178 Ga0265323_10005345
179 Ga0265325_10115255
180 Ga0265340_10048211
181 Ga0265316_10000808
182 Ga0265316_10002307
183 Ga0265316_10002688
184 Ga0265316_10005411
185 Ga0265316_10006875
186 Ga0265316_10009997
187 Ga0265316_10014035
188 Ga0265316_10014553
189 Ga0265316_10028984
190 Ga0265316_10031691
191 Ga0265316_10040419
192 Ga0265316_10043447
193 Ga0265316_10054779
194 Ga0265316_10059795
195 Ga0265316_10079822
196 Ga0265316_10122263
197 Ga0265314_10021345
198 Ga0265342_10027323
199 Ga0265342_10028880
200 Ga0265342_10106067
201 Ga0316576_10075348
202 Ga0316577_10000250
203 Ga0373937_0201511
204 Ga0316582_0188328
205 Ga0316584_0002048
206 Ga0373925_0106266
207 Ga0395898_0086438
208 Ga0466966_0106124
209 Ga0466963_0111908
210 Ga0453684_0040531
211 Ga0453684_0214065
212 Ga0453684_0300631
213 Ga0451576_0542642
214 Ga0495651_0093138
215 Ga0495580_0050416
216 Ga0495580_0222263
217 Ga0495582_0154875
218 Ga0495662_0008957
219 Ga0495630_0029368
220 Ga0495652_0135637
221 Ga0495640_0061150
222 Ga0495587_0074642
223 Ga0495645_0026406
224 Ga0495645_0092953
225 Ga0495667_0026688
226 Ga0495635_0033100
227 Ga0495599_0204869
228 Ga0495623_0049531
229 Ga0495646_0029435
230 Ga0495613_0061776
231 Ga0495600_0042862
232 Ga0495604_0014126
233 Ga0495674_0014023
234 Ga0495674_0083539
235 Ga0495674_0125156
236 Ga0495680_0074224
237 Ga0495675_0038112
238 Ga0495684_0000364
239 Ga0495684_0047708
240 Ga0495602_0005811
241 Ga0495602_0285757
242 Ga0496109_0593726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04015

DUF362

Domain of unknown function (DUF362)

97

315

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s91-assembly1.cif.gz_A structure of the malate racemase mar2 apoprotein from thermoanaerobacterium thermosaccharolyticum at 2.25 angstroms resolution 0.6066 57 315
5zw4-assembly1.cif.gz_A crystal structure of trna bound trmr 0.5751 63 194
3axh-assembly1.cif.gz_A crystal structure of isomaltase in complex with isomaltose 0.5728 80 157
3gns-assembly1.cif.gz_A crystal structure of the staphylococcus aureus enoyl-acyl carrier protein reductase (fabi) in apo form (one molecule in au) 0.5725 67 157
2w9x-assembly1.cif.gz_B the active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions 0.5685 82 157
ID Description Score Start End Superfamily
4narA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LarA, N-terminal domain 0.5742 57 315 3.40.50.11440
af_Q54EC8_16_157_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.5679 62 157 3.40.50.150
af_Q55GE6_1227_1423_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5677 73 157 3.40.50.300
4narA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LarA, N-terminal domain 0.567 57 315 3.40.50.11440
2waaA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.5665 104 157 3.40.50.1110
ID Description Score Start End GO Terms
AF-A0A7C2IJW7-F1-model_v4 DUF362 domain-containing protein 0.9922 118 364
AF-A0A7V6ECV4-F1-model_v4 DUF362 domain-containing protein 0.992 80 364
AF-A0A7X6SQ32-F1-model_v4 DUF362 domain-containing protein 0.9828 258 356
AF-A0A7V6ECV4-F1-model_v4 DUF362 domain-containing protein 0.975 80 364
AF-A0A7C2IJW7-F1-model_v4 DUF362 domain-containing protein 0.9726 118 364

Map