F110672

General Info

Members Datasets Scaffolds Average Seq Length
121 73 120 295

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10004975|Ga0265338_100049758
Length 338
Sequence MSLLRQAFGAQGPRVHRRGRVWLPPIRLSCRARLLRSRAVSVDAPWRIWLEAARPRTLPAAVAPVIVGSALAWRAGAFDPMAAGICLVFALLVQIGANFANDYFDFVKGADTRARVGPRRAVAAGLVAPATMRRAVGLVLGLAFATGLALVAWGGWWLVAIGVASIASGIAYTGGPYPLGYHGLGDVFVFVFFGLVAVGATFYVQAGWVSADVLLAAVAVGALTTNILVVNNYRDAESDARAGKRTLVVRFGRRFAEVQFAAAHVAASAVLVALAWRGLYPRTLGVGLALVFAAGGYRQWRGLRPGRLPGDLIGLLGRCGAWLAAYALALAAALAIGR

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
16 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
19 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
28 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
29 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
30 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
31 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
32 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
33 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
34 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
35 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
38 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
42 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
43 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
44 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
45 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
54 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
55 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
69 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
70 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
71 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
72 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 92.56
Stem 0
Stem Tuber 0
Unclassified 7.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10003577 3300003320 Bacteria 14407
2 rootH2_10031179 3300003320 Bacteria 10184
3 rootL2_10054080 3300003322 Unclassified 3178
4 rootL2_10115564 3300003322 Bacteria 4437
5 rootL2_10192381 3300003322 Unclassified 2473
6 rootH1_10087654 3300003323 Bacteria 4696
7 rootH1_10120945 3300003323 Bacteria 5083
8 Ga0070683_100004815 3300005329 Bacteria 11175
9 Ga0068869_100000593 3300005334 Bacteria 20315
10 Ga0068868_100051080 3300005338 Bacteria 3250
11 Ga0068868_100187454 3300005338 Bacteria 1719
12 Ga0070713_100013192 3300005436 Bacteria 6093
13 Ga0068867_100000513 3300005459 Bacteria 25828
14 Ga0070679_100030626 3300005530 Bacteria 5313
15 Ga0068857_100102170 3300005577 Bacteria 2573
16 Ga0068856_100000286 3300005614 Bacteria 55139
17 Ga0070717_10000304 3300006028 Bacteria 32329
18 Ga0097621_100119383 3300006237 Bacteria 2235
19 Ga0068871_100006641 3300006358 Bacteria 8206
20 Ga0068865_100001122 3300006881 Bacteria 15485
21 Ga0157369_10142457 3300013105 Bacteria 2536
22 Ga0163163_10092155 3300014325 Bacteria 3045
23 Ga0207652_10021620 3300025921 Bacteria 5311
24 Ga0207700_10009091 3300025928 Bacteria 6188
25 Ga0207704_10001741 3300025938 Bacteria 9749
26 Ga0207689_10000497 3300025942 Bacteria 37074
27 Ga0207677_10041271 3300026023 Bacteria 3050
28 Ga0207702_10000078 3300026078 Bacteria 110866
29 Ga0207648_10002792 3300026089 Bacteria 18522
30 Ga0207674_10118891 3300026116 Bacteria 2612
31 Ga0265319_1006849 3300028563 Bacteria 5212
32 Ga0265319_1007257 3300028563 Bacteria 5010
33 Ga0265334_10004109 3300028573 Bacteria 6522
34 Ga0265334_10006451 3300028573 Bacteria 5048
35 Ga0265318_10000047 3300028577 Bacteria 123944
36 Ga0265318_10002936 3300028577 Bacteria 8847
37 Ga0265323_10000101 3300028653 Bacteria 48976
38 Ga0265323_10001925 3300028653 Bacteria 9792
39 Ga0265323_10002879 3300028653 Bacteria 7726
40 Ga0265322_10003254 3300028654 Bacteria 4928
41 Ga0265322_10021051 3300028654 Bacteria 1868
42 Ga0265338_10004975 3300028800 Bacteria 17602
43 Ga0265338_10153565 3300028800 Bacteria 1786
44 Ga0265324_10033968 3300029957 Bacteria 1777
45 Ga0265330_10085190 3300031235 Bacteria 1359
46 Ga0265332_10030911 3300031238 Bacteria 2337
47 Ga0265320_10001733 3300031240 Bacteria 15467
48 Ga0265320_10006858 3300031240 Bacteria 7131
49 Ga0265320_10024526 3300031240 Bacteria 3188
50 Ga0265320_10066554 3300031240 Bacteria 1707
51 Ga0265320_10073500 3300031240 Bacteria 1606
52 Ga0265320_10091016 3300031240 Bacteria 1413
53 Ga0265325_10066163 3300031241 Bacteria 1823
54 Ga0265331_10008757 3300031250 Bacteria 5735
55 Ga0265331_10012708 3300031250 Bacteria 4550
56 Ga0265327_10000016 3300031251 Bacteria 467439
57 Ga0265327_10001991 3300031251 Bacteria 23180
58 Ga0265316_10014927 3300031344 Bacteria 6813
59 Ga0265316_10048999 3300031344 Bacteria 3330
60 Ga0265316_10154377 3300031344 Bacteria 1718
61 Ga0307408_100000007 3300031548 Bacteria 463086
62 Ga0265313_10001702 3300031595 Bacteria 20254
63 Ga0265313_10003238 3300031595 Bacteria 13384
64 Ga0265313_10005342 3300031595 Bacteria 9486
65 Ga0307508_10001230 3300031616 Bacteria 29272
66 Ga0265314_10007381 3300031711 Bacteria 9538
67 Ga0265342_10004537 3300031712 Bacteria 10883
68 Ga0265342_10004685 3300031712 Bacteria 10649
69 Ga0265342_10092617 3300031712 Bacteria 1731
70 Ga0307413_10203326 3300031824 Bacteria 1432
71 Ga0307410_10000053 3300031852 Bacteria 40797
72 Ga0307412_10060271 3300031911 Bacteria 2546
73 Ga0307409_100000254 3300031995 Bacteria 21561
74 Ga0307416_100000075 3300032002 Bacteria 77549
75 Ga0307411_10184609 3300032005 Bacteria 1586
76 Ga0395905_0000015 3300037471 Bacteria 393880
77 Ga0451577_0000226 3300042876 Bacteria 114990
78 Ga0451577_0109147 3300042876 Bacteria 2474
79 Ga0453683_0000403 3300044673 Bacteria 50902
80 Ga0466966_0038579 3300044684 Bacteria 3079
81 Ga0453684_0049733 3300044712 Bacteria 5523
82 Ga0453684_0073808 3300044712 Bacteria 4299
83 Ga0453684_0272045 3300044712 Unclassified 1935
84 Ga0451576_0002284 3300045051 Bacteria 29183
85 Ga0451576_0002300 3300045051 Bacteria 28962
86 Ga0451576_0011408 3300045051 Bacteria 10100
87 Ga0451576_0012665 3300045051 Bacteria 9469
88 Ga0451576_0088521 3300045051 Bacteria 3221
89 Ga0451576_0220391 3300045051 Bacteria 1981
90 Ga0466967_0083773 3300045976 Archaea 2884
91 Ga0501032_0001153 3300049569 Bacteria 21165
92 Ga0501033_0002665 3300049570 Bacteria 14997
93 Ga0501033_0004538 3300049570 Bacteria 11114
94 Ga0501034_0381961 3300049571 Bacteria 1333
95 Ga0501036_0019361 3300049572 Bacteria 5712
96 Ga0501038_0001447 3300049574 Bacteria 21797
97 Ga0501043_0079426 3300049579 Bacteria 2578
98 Ga0501046_0003174 3300049580 Bacteria 15176
99 Ga0501046_0074156 3300049580 Bacteria 2640
100 Ga0501046_0083446 3300049580 Bacteria 2466
101 Ga0501046_0175068 3300049580 Bacteria 1607
102 Ga0501047_0000958 3300049581 Bacteria 29231
103 Ga0501047_0033128 3300049581 Bacteria 4988
104 Ga0501047_0262505 3300049581 Bacteria 1574
105 Ga0501048_0027789 3300049582 Bacteria 4107
106 Ga0501048_0397306 3300049582 Bacteria 985
107 Ga0501070_0294759 3300049586 Bacteria 1322
108 Ga0501243_000006 3300049675 Bacteria 22334
109 Ga0501080_0118144 3300049742 Bacteria 2458
110 Ga0501080_0199138 3300049742 Archaea 1839
111 Ga0501080_0203674 3300049742 Bacteria 1816
112 Ga0501083_0001769 3300049744 Bacteria 14763
113 Ga0501083_0058714 3300049744 Bacteria 2574
114 Ga0501035_0003245 3300049822 Bacteria 15580
115 Ga0501035_0014001 3300049822 Bacteria 7399
116 Ga0501035_0020441 3300049822 Bacteria 6079
117 Ga0501035_0240160 3300049822 Bacteria 1541
118 Ga0501044_0001252 3300049823 Bacteria 30143
119 Ga0501044_0029215 3300049823 Bacteria 5814
120 Ga0501044_0030787 3300049823 Bacteria 5652

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10192381 rootL2_101923814 251
2 3300049744 Ga0501083_0001769 Ga0501083_0001769_9051_9974 265
3 3300045051 Ga0451576_0220391 Ga0451576_0220391_911_1726 270
4 3300044684 Ga0466966_0038579 Ga0466966_0038579_2054_2872 271
5 3300031240 Ga0265320_10001733 Ga0265320_100017338 274
6 3300005436 Ga0070713_100013192 Ga0070713_1000131924 275
7 3300025928 Ga0207700_10009091 Ga0207700_100090915 275
8 3300028800 Ga0265338_10153565 Ga0265338_101535654 276
9 3300031240 Ga0265320_10091016 Ga0265320_100910162 276
10 3300031595 Ga0265313_10005342 Ga0265313_100053426 276
11 3300044673 Ga0453683_0000403 Ga0453683_0000403_844_1734 276
12 3300044712 Ga0453684_0049733 Ga0453684_0049733_1841_2671 276
13 3300045051 Ga0451576_0002300 Ga0451576_0002300_13003_13893 276
14 3300005329 Ga0070683_100004815 Ga0070683_1000048156 277
15 3300013105 Ga0157369_10142457 Ga0157369_101424573 277
16 3300028654 Ga0265322_10021051 Ga0265322_100210512 277
17 3300031344 Ga0265316_10154377 Ga0265316_101543773 277
18 3300031595 Ga0265313_10001702 Ga0265313_1000170215 277
19 3300031712 Ga0265342_10004537 Ga0265342_100045377 277
20 3300031548 Ga0307408_100000007 Ga0307408_10000000745 279
21 3300031824 Ga0307413_10203326 Ga0307413_102033262 279
22 3300031852 Ga0307410_10000053 Ga0307410_100000534 279
23 3300031911 Ga0307412_10060271 Ga0307412_100602712 279
24 3300031995 Ga0307409_100000254 Ga0307409_1000002543 279
25 3300032002 Ga0307416_100000075 Ga0307416_1000000755 279
26 3300032005 Ga0307411_10184609 Ga0307411_101846092 279
27 3300049581 Ga0501047_0033128 Ga0501047_0033128_2560_3441 279
28 3300049822 Ga0501035_0014001 Ga0501035_0014001_4666_5547 279
29 3300003322 rootL2_10115564 rootL2_101155644 280
30 3300003323 rootH1_10120945 rootH1_101209454 280
31 3300031251 Ga0265327_10001991 Ga0265327_1000199117 281
32 3300031616 Ga0307508_10001230 Ga0307508_1000123013 281
33 3300028653 Ga0265323_10000101 Ga0265323_1000010113 282
34 3300045051 Ga0451576_0088521 Ga0451576_0088521_754_1638 283
35 3300049582 Ga0501048_0397306 Ga0501048_0397306_91_960 286
36 3300028563 Ga0265319_1007257 Ga0265319_10072574 288
37 3300031240 Ga0265320_10066554 Ga0265320_100665543 288
38 3300031240 Ga0265320_10073500 Ga0265320_100735002 288
39 3300031712 Ga0265342_10092617 Ga0265342_100926171 288
40 3300045051 Ga0451576_0011408 Ga0451576_0011408_2298_3212 288
41 3300045051 Ga0451576_0012665 Ga0451576_0012665_1336_2250 288
42 3300049569 Ga0501032_0001153 Ga0501032_0001153_14394_15275 288
43 3300049570 Ga0501033_0002665 Ga0501033_0002665_13308_14189 288
44 3300049572 Ga0501036_0019361 Ga0501036_0019361_1409_2290 288
45 3300049574 Ga0501038_0001447 Ga0501038_0001447_2437_3318 288
46 3300049580 Ga0501046_0175068 Ga0501046_0175068_201_1082 288
47 3300049582 Ga0501048_0027789 Ga0501048_0027789_225_1106 288
48 3300049742 Ga0501080_0199138 Ga0501080_0199138_297_1178 288
49 3300049822 Ga0501035_0020441 Ga0501035_0020441_1281_2162 288
50 3300049823 Ga0501044_0029215 Ga0501044_0029215_4102_4983 288
51 3300003322 rootL2_10054080 rootL2_100540801 289
52 3300005334 Ga0068869_100000593 Ga0068869_1000005937 289
53 3300005338 Ga0068868_100051080 Ga0068868_1000510803 289
54 3300005459 Ga0068867_100000513 Ga0068867_10000051315 289
55 3300006237 Ga0097621_100119383 Ga0097621_1001193832 289
56 3300006358 Ga0068871_100006641 Ga0068871_1000066412 289
57 3300006881 Ga0068865_100001122 Ga0068865_10000112211 289
58 3300025938 Ga0207704_10001741 Ga0207704_1000174111 289
59 3300025942 Ga0207689_10000497 Ga0207689_1000049731 289
60 3300026023 Ga0207677_10041271 Ga0207677_100412713 289
61 3300026089 Ga0207648_10002792 Ga0207648_1000279215 289
62 3300028573 Ga0265334_10004109 Ga0265334_100041096 289
63 3300028577 Ga0265318_10000047 Ga0265318_1000004758 289
64 3300028653 Ga0265323_10001925 Ga0265323_1000192510 289
65 3300028654 Ga0265322_10003254 Ga0265322_100032546 289
66 3300029957 Ga0265324_10033968 Ga0265324_100339683 289
67 3300031235 Ga0265330_10085190 Ga0265330_100851902 289
68 3300031238 Ga0265332_10030911 Ga0265332_100309114 289
69 3300031240 Ga0265320_10024526 Ga0265320_100245264 289
70 3300031241 Ga0265325_10066163 Ga0265325_100661632 289
71 3300031250 Ga0265331_10012708 Ga0265331_100127085 289
72 3300031344 Ga0265316_10014927 Ga0265316_100149276 289
73 3300031595 Ga0265313_10003238 Ga0265313_1000323812 289
74 3300031711 Ga0265314_10007381 Ga0265314_100073819 289
75 3300031712 Ga0265342_10004685 Ga0265342_100046856 289
76 3300049675 Ga0501243_000006 Ga0501243_000006_1749_2639 289
77 3300003320 rootH2_10031179 rootH2_100311794 290
78 3300005338 Ga0068868_100187454 Ga0068868_1001874541 290
79 3300005530 Ga0070679_100030626 Ga0070679_1000306263 290
80 3300005577 Ga0068857_100102170 Ga0068857_1001021703 290
81 3300005614 Ga0068856_100000286 Ga0068856_10000028649 290
82 3300006028 Ga0070717_10000304 Ga0070717_1000030431 290
83 3300014325 Ga0163163_10092155 Ga0163163_100921552 290
84 3300025921 Ga0207652_10021620 Ga0207652_100216206 290
85 3300026078 Ga0207702_10000078 Ga0207702_1000007851 290
86 3300026116 Ga0207674_10118891 Ga0207674_101188911 290
87 3300028563 Ga0265319_1006849 Ga0265319_10068497 290
88 3300028573 Ga0265334_10006451 Ga0265334_100064513 290
89 3300028577 Ga0265318_10002936 Ga0265318_100029365 290
90 3300028653 Ga0265323_10002879 Ga0265323_100028794 290
91 3300028800 Ga0265338_10004975 Ga0265338_100049758 290
92 3300031240 Ga0265320_10006858 Ga0265320_100068583 290
93 3300031250 Ga0265331_10008757 Ga0265331_100087576 290
94 3300031251 Ga0265327_10000016 Ga0265327_10000016147 290
95 3300031344 Ga0265316_10048999 Ga0265316_100489995 290
96 3300037471 Ga0395905_0000015 Ga0395905_0000015_155928_156833 290
97 3300042876 Ga0451577_0000226 Ga0451577_0000226_80419_81306 290
98 3300042876 Ga0451577_0109147 Ga0451577_0109147_1166_2062 290
99 3300044712 Ga0453684_0073808 Ga0453684_0073808_631_1518 290
100 3300044712 Ga0453684_0272045 Ga0453684_0272045_159_1052 290
101 3300045051 Ga0451576_0002284 Ga0451576_0002284_25243_26154 290
102 3300049570 Ga0501033_0004538 Ga0501033_0004538_2470_3387 290
103 3300049571 Ga0501034_0381961 Ga0501034_0381961_318_1199 290
104 3300049579 Ga0501043_0079426 Ga0501043_0079426_127_1023 290
105 3300049580 Ga0501046_0003174 Ga0501046_0003174_6447_7364 290
106 3300049580 Ga0501046_0074156 Ga0501046_0074156_1272_2174 290
107 3300049580 Ga0501046_0083446 Ga0501046_0083446_391_1293 290
108 3300049581 Ga0501047_0000958 Ga0501047_0000958_19195_20097 290
109 3300049581 Ga0501047_0262505 Ga0501047_0262505_45_962 290
110 3300049586 Ga0501070_0294759 Ga0501070_0294759_16_933 290
111 3300049742 Ga0501080_0118144 Ga0501080_0118144_926_1843 290
112 3300049742 Ga0501080_0203674 Ga0501080_0203674_725_1627 290
113 3300049744 Ga0501083_0058714 Ga0501083_0058714_1487_2377 290
114 3300049822 Ga0501035_0003245 Ga0501035_0003245_9408_10310 290
115 3300049822 Ga0501035_0240160 Ga0501035_0240160_565_1482 290
116 3300049823 Ga0501044_0001252 Ga0501044_0001252_21467_22369 290
117 3300049823 Ga0501044_0030787 Ga0501044_0030787_3029_3946 290
118 iso_pu_bacteria 2786546940 2788437529 290
119 3300003320 rootH2_10003577 rootH2_100035779 291
120 3300003323 rootH1_10087654 rootH1_100876545 291
121 3300045976 Ga0466967_0083773 Ga0466967_0083773_1949_2851 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

61

309

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8djm-assembly1.cif.gz_B hmgcr-ubiad1 complex state 1 0.8382 4 288
8djm-assembly1.cif.gz_B hmgcr-ubiad1 complex state 1 0.7864 4 288
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7371 12 289
4tq6-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7298 8 289
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7139 12 289
ID Description Score Start End Superfamily
af_P9WIP3_19_264_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9662 17 260 1.10.357.140
af_P32166_24_288_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9558 17 272 1.20.1070.10
af_P9WIP3_19_264_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9395 17 260 1.10.357.140
af_Q2FZM0_184_310_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9363 170 290 1.20.120.1780
af_Q2FZM0_17_182_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9322 8 166 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A5D3YRY3-F1-model_v4 1,4-dihydroxy-2-naphthoate octaprenyltransferase (DHNA-octaprenyltransferase) (EC 2.5.1.74) 0.9911 3 290 GO:0005886
GO:0009234
GO:0032194
GO:0042371
GO:0046428
AF-A0A4U1JA02-F1-model_v4 1,4-dihydroxy-2-naphthoate octaprenyltransferase (DHNA-octaprenyltransferase) (EC 2.5.1.74) 0.9898 1 291 GO:0005886
GO:0009234
GO:0032194
GO:0042371
GO:0046428
AF-A0A534XTF4-F1-model_v4 1,4-dihydroxy-2-naphthoate octaprenyltransferase (EC 2.5.1.74) 0.9896 1 222 GO:0009234
GO:0016020
GO:0032194
GO:0042371
GO:0046428
AF-A0A1X7CBQ9-F1-model_v4 1,4-dihydroxy-2-naphthoate octaprenyltransferase (DHNA-octaprenyltransferase) (EC 2.5.1.74) 0.9891 1 289 GO:0005886
GO:0009234
GO:0032194
GO:0042371
GO:0046428
AF-A0A3M2C1T3-F1-model_v4 1,4-dihydroxy-2-naphthoate octaprenyltransferase (DHNA-octaprenyltransferase) (EC 2.5.1.74) 0.9883 2 289 GO:0005886
GO:0009234
GO:0032194
GO:0042371
GO:0046428

Feature Viewer

pLDDT pTM Quality
91.12 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map