F110056

General Info

Members Datasets Scaffolds Average Seq Length
121 83 242 189

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10053571|Ga0105249_100535714
Length 214
Sequence MKDFIATIRPAIVSTLVFTGLLGLVYPAVIGGIAAVAFPDQAKGSLIHDRTGTVVGSKLIGQPFDNPAYFWSRPTAVTAYQAMTSSGTNAGPSGFIDKAGTIGPNPALTDVVKARIQALRDADPGNTARVPVDLVTASASGLDPHITPAAAYYQVGRVARARGVPEAQLRELVDQHVEERTLGVLGERRVNVLQLNLALDARLGAPKEAPYERR

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
50 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
51 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
52 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
53 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
54 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
55 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
56 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
57 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
58 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
68 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
75 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
76 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
77 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
78 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
80 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
81 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
82 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
83 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.65
Rhizosphere 97.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10053571 3300009553 Bacteria 3688
2 Ga0070666_10280278 3300005335 Bacteria 1185
3 Ga0070668_100060136 3300005347 Bacteria 2941
4 Ga0070671_100462762 3300005355 Bacteria 1089
5 Ga0070674_100337737 3300005356 Bacteria 1212
6 Ga0070674_101086302 3300005356 Bacteria 706
7 Ga0070667_100280318 3300005367 Bacteria 1496
8 Ga0070713_100000019 3300005436 Bacteria 110100
9 Ga0068867_100247691 3300005459 Bacteria 1448
10 Ga0070706_100419510 3300005467 Bacteria 1245
11 Ga0070707_100126943 3300005468 Bacteria 2479
12 Ga0070707_100379365 3300005468 Bacteria 1373
13 Ga0070698_100075620 3300005471 Bacteria 3371
14 Ga0070698_100873437 3300005471 Bacteria 845
15 Ga0068853_100734170 3300005539 Bacteria 943
16 Ga0070665_100364242 3300005548 Bacteria 1452
17 Ga0068866_10326770 3300005718 Bacteria 967
18 Ga0068861_100661683 3300005719 Bacteria 966
19 Ga0068863_100047160 3300005841 Bacteria 4088
20 Ga0068863_100654431 3300005841 Bacteria 1042
21 Ga0068860_100283897 3300005843 Bacteria 1618
22 Ga0068860_100749406 3300005843 Bacteria 988
23 Ga0097621_100389636 3300006237 Bacteria 1246
24 Ga0097621_100657449 3300006237 Bacteria 962
25 Ga0068871_100182389 3300006358 Bacteria 1804
26 Ga0075434_100258907 3300006871 Bacteria 1759
27 Ga0075434_100979117 3300006871 Bacteria 860
28 Ga0075436_100520966 3300006914 Bacteria 871
29 Ga0111539_10999706 3300009094 Bacteria 972
30 Ga0105245_10000600 3300009098 Bacteria 32652
31 Ga0105245_10807618 3300009098 Bacteria 976
32 Ga0114129_11011659 3300009147 Bacteria 1046
33 Ga0105241_10037415 3300009174 Bacteria 3656
34 Ga0105248_10042374 3300009177 Bacteria 5105
35 Ga0105248_11331787 3300009177 Bacteria 812
36 Ga0157327_1004616 3300012512 Bacteria 1076
37 Ga0157375_10343472 3300013308 Bacteria 1658
38 Ga0163163_10846570 3300014325 Bacteria 978
39 Ga0157380_11387099 3300014326 Bacteria 753
40 Ga0157376_10197574 3300014969 Bacteria 1848
41 Ga0207680_10285695 3300025903 Bacteria 1147
42 Ga0207685_10440685 3300025905 Bacteria 675
43 Ga0207699_10059295 3300025906 Bacteria 2293
44 Ga0207684_10170779 3300025910 Bacteria 1874
45 Ga0207654_10006494 3300025911 Bacteria 5885
46 Ga0207693_10243489 3300025915 Bacteria 1412
47 Ga0207646_10284219 3300025922 Bacteria 1495
48 Ga0207646_11045150 3300025922 Bacteria 720
49 Ga0207687_10000421 3300025927 Bacteria 28819
50 Ga0207700_10000035 3300025928 Bacteria 119648
51 Ga0207644_10163312 3300025931 Bacteria 1733
52 Ga0207639_11056124 3300026041 Bacteria 761
53 Ga0207641_10185851 3300026088 Bacteria 1906
54 Ga0207676_11063042 3300026095 Bacteria 799
55 Ga0207675_100262973 3300026118 Bacteria 1673
56 Ga0207675_101197609 3300026118 Bacteria 780
57 Ga0207683_10221709 3300026121 Bacteria 1723
58 Ga0268266_10307534 3300028379 Bacteria 1480
59 Ga0268265_10223579 3300028380 Bacteria 1649
60 Ga0265337_1092702 3300028556 Bacteria 823
61 Ga0265336_10001339 3300028666 Bacteria 11457
62 Ga0265324_10000001 3300029957 Bacteria 562975
63 Ga0265324_10010806 3300029957 Bacteria 3501
64 Ga0265324_10065690 3300029957 Bacteria 1238
65 Ga0265330_10007342 3300031235 Bacteria 5375
66 Ga0265330_10010511 3300031235 Bacteria 4359
67 Ga0265330_10078091 3300031235 Bacteria 1428
68 Ga0265332_10000096 3300031238 Bacteria 76689
69 Ga0265332_10001968 3300031238 Bacteria 10818
70 Ga0265328_10002128 3300031239 Bacteria 8937
71 Ga0265320_10027689 3300031240 Bacteria 2952
72 Ga0265325_10000150 3300031241 Bacteria 49297
73 Ga0265325_10017989 3300031241 Bacteria 3923
74 Ga0265325_10134058 3300031241 Bacteria 1183
75 Ga0265329_10001734 3300031242 Bacteria 10423
76 Ga0265329_10029017 3300031242 Bacteria 1811
77 Ga0265340_10105990 3300031247 Bacteria 1303
78 Ga0265339_10023836 3300031249 Bacteria 3534
79 Ga0265339_10374413 3300031249 Bacteria 668
80 Ga0265331_10000184 3300031250 Bacteria 76712
81 Ga0265331_10001273 3300031250 Bacteria 18843
82 Ga0265331_10002869 3300031250 Bacteria 11395
83 Ga0265331_10010083 3300031250 Bacteria 5248
84 Ga0265331_10027971 3300031250 Bacteria 2822
85 Ga0265331_10339914 3300031250 Bacteria 672
86 Ga0265327_10000694 3300031251 Bacteria 53609
87 Ga0265327_10000739 3300031251 Bacteria 51006
88 Ga0265327_10003295 3300031251 Bacteria 15642
89 Ga0265327_10073714 3300031251 Bacteria 1702
90 Ga0265316_10000707 3300031344 Bacteria 36959
91 Ga0265316_10043095 3300031344 Bacteria 3601
92 Ga0265316_10069912 3300031344 Bacteria 2709
93 Ga0265316_10118898 3300031344 Bacteria 1997
94 Ga0265314_10000185 3300031711 Bacteria 92226
95 Ga0265314_10002007 3300031711 Bacteria 21603
96 Ga0265314_10038794 3300031711 Bacteria 3438
97 Ga0265314_10047016 3300031711 Bacteria 3041
98 Ga0265342_10044267 3300031712 Bacteria 2683
99 Ga0265342_10052822 3300031712 Bacteria 2420
100 Ga0373960_0038194 3300035121 Bacteria 1375
101 Ga0373931_0343075 3300035691 Bacteria 933
102 Ga0373927_0511731 3300035695 Bacteria 793
103 Ga0373933_0077041 3300035724 Bacteria 2038
104 Ga0373947_0072088 3300035725 Bacteria 2120
105 Ga0373937_0025455 3300036401 Bacteria 5342
106 Ga0451577_1080303 3300042876 Bacteria 719
107 Ga0453683_0428278 3300044673 Bacteria 854
108 Ga0451576_0316975 3300045051 Bacteria 1632
109 Ga0495625_0002346 3300046660 Bacteria 20658
110 Ga0496108_0326530 3300048911 Bacteria 1338
111 Ga0496114_0693617 3300048917 Bacteria 893
112 Ga0496124_0002223 3300048927 Bacteria 25841
113 Ga0501042_0231374 3300049578 Bacteria 1333
114 Ga0501075_0292526 3300049591 Bacteria 1241
115 nmdc:mga05p37_2808_c1 3300050507 Bacteria 17084
116 nmdc:mga05p37_962425_c1 3300050507 Bacteria 912
117 nmdc:mga0n895_190629_c1 3300050512 Bacteria 2081
118 nmdc:mga0n895_253340_c1 3300050512 Bacteria 1786
119 nmdc:mga0rr50_216655_c1 3300050513 Bacteria 1579
120 nmdc:mga0rr50_359936_c1 3300050513 Bacteria 1224
121 nmdc:mga08x19_261084_c1 3300050514 Bacteria 1197
122 Ga0105249_10053571
123 Ga0070666_10280278
124 Ga0070668_100060136
125 Ga0070671_100462762
126 Ga0070674_100337737
127 Ga0070674_101086302
128 Ga0070667_100280318
129 Ga0070713_100000019
130 Ga0068867_100247691
131 Ga0070706_100419510
132 Ga0070707_100126943
133 Ga0070707_100379365
134 Ga0070698_100075620
135 Ga0070698_100873437
136 Ga0068853_100734170
137 Ga0070665_100364242
138 Ga0068866_10326770
139 Ga0068861_100661683
140 Ga0068863_100047160
141 Ga0068863_100654431
142 Ga0068860_100283897
143 Ga0068860_100749406
144 Ga0097621_100389636
145 Ga0097621_100657449
146 Ga0068871_100182389
147 Ga0075434_100258907
148 Ga0075434_100979117
149 Ga0075436_100520966
150 Ga0111539_10999706
151 Ga0105245_10000600
152 Ga0105245_10807618
153 Ga0114129_11011659
154 Ga0105241_10037415
155 Ga0105248_10042374
156 Ga0105248_11331787
157 Ga0157327_1004616
158 Ga0157375_10343472
159 Ga0163163_10846570
160 Ga0157380_11387099
161 Ga0157376_10197574
162 Ga0207680_10285695
163 Ga0207685_10440685
164 Ga0207699_10059295
165 Ga0207684_10170779
166 Ga0207654_10006494
167 Ga0207693_10243489
168 Ga0207646_10284219
169 Ga0207646_11045150
170 Ga0207687_10000421
171 Ga0207700_10000035
172 Ga0207644_10163312
173 Ga0207639_11056124
174 Ga0207641_10185851
175 Ga0207676_11063042
176 Ga0207675_100262973
177 Ga0207675_101197609
178 Ga0207683_10221709
179 Ga0268266_10307534
180 Ga0268265_10223579
181 Ga0265337_1092702
182 Ga0265336_10001339
183 Ga0265324_10000001
184 Ga0265324_10010806
185 Ga0265324_10065690
186 Ga0265330_10007342
187 Ga0265330_10010511
188 Ga0265330_10078091
189 Ga0265332_10000096
190 Ga0265332_10001968
191 Ga0265328_10002128
192 Ga0265320_10027689
193 Ga0265325_10000150
194 Ga0265325_10017989
195 Ga0265325_10134058
196 Ga0265329_10001734
197 Ga0265329_10029017
198 Ga0265340_10105990
199 Ga0265339_10023836
200 Ga0265339_10374413
201 Ga0265331_10000184
202 Ga0265331_10001273
203 Ga0265331_10002869
204 Ga0265331_10010083
205 Ga0265331_10027971
206 Ga0265331_10339914
207 Ga0265327_10000694
208 Ga0265327_10000739
209 Ga0265327_10003295
210 Ga0265327_10073714
211 Ga0265316_10000707
212 Ga0265316_10043095
213 Ga0265316_10069912
214 Ga0265316_10118898
215 Ga0265314_10000185
216 Ga0265314_10002007
217 Ga0265314_10038794
218 Ga0265314_10047016
219 Ga0265342_10044267
220 Ga0265342_10052822
221 Ga0373960_0038194
222 Ga0373931_0343075
223 Ga0373927_0511731
224 Ga0373933_0077041
225 Ga0373947_0072088
226 Ga0373937_0025455
227 Ga0451577_1080303
228 Ga0453683_0428278
229 Ga0451576_0316975
230 Ga0495625_0002346
231 Ga0496108_0326530
232 Ga0496114_0693617
233 Ga0496124_0002223
234 Ga0501042_0231374
235 Ga0501075_0292526
236 nmdc:mga05p37_2808_c1
237 nmdc:mga05p37_962425_c1
238 nmdc:mga0n895_190629_c1
239 nmdc:mga0n895_253340_c1
240 nmdc:mga0rr50_216655_c1
241 nmdc:mga0rr50_359936_c1
242 nmdc:mga08x19_261084_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

8

201

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.6979 7 191
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.6972 7 191
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.6878 7 191
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.679 7 191
5i41-assembly1.cif.gz_B structure of the apo raca dna binding domain 0.5038 142 189
ID Description Score Start End Superfamily
af_Q2M2S1_263_336_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.6217 133 188 1.10.8.60
5i44I00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.5197 142 189 1.10.1660.10
af_Q2M2S1_263_336_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.5067 133 188 1.10.8.60
5i41B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.5038 142 189 1.10.1660.10
4r4eA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.5007 142 190 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A434LXJ6-F1-model_v4 Potassium-transporting ATPase subunit C 0.9599 124 191 GO:0005524
GO:0005886
GO:0008556
AF-A0A3N5MMD9-F1-model_v4 Potassium-transporting ATPase subunit KdpA (EC 3.6.3.12) 0.9539 106 190 GO:0005886
GO:0008556
GO:0016787
AF-A0A2R7S9R5-F1-model_v4 deleted 0.9492 133 189
AF-A0A6L4Y978-F1-model_v4 K+-transporting ATPase ATPase C chain 0.9464 116 189 GO:0005524
GO:0005886
GO:0008556
AF-A0A4Q3NCE3-F1-model_v4 Potassium-transporting ATPase subunit C 0.9448 127 189 GO:0005524
GO:0005886
GO:0008556

Map