F104182

General Info

Members Datasets Scaffolds Average Seq Length
120 92 107 147

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10040540|Ga0055531_100405402
Length 172
Sequence MSELRSELCTAKTQSISFMYSLLLFTHSLWRWLVLISLVYAIFRGIRGRIRQLPFTATDNRARHFTATIAHIQLIIGYALYFNSPVISYFRSNFHTAVRQPEFLFFGLIHVIGMTMSIVLITVGSSMSKRQATDREKFNVMAFWFTLALLXIFVTIPWPFSPLANRPYLRHF

Samples

Sample ID Description Type Environment
1 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
4 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
5 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
6 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
7 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
8 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
9 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
10 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
11 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
37 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
38 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
40 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
42 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
56 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
57 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
58 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
59 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
60 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
61 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
62 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
63 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
64 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
65 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
66 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
67 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
68 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
69 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
70 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
71 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
72 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
73 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
74 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
75 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
76 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
77 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
78 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
79 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
80 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
81 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
82 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
83 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
84 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
85 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
86 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
87 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
88 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
89 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
90 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
91 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
92 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.17
Metatranscriptomes 0
Isolates 10.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 42.5
Nodule 0
Rhizoplane 0.83
Rhizosphere 39.17
Stem 0
Stem Tuber 0
Unclassified 17.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002722 3300001989 Bacteria 6805
2 JGI25162J39368_1000301 3300002737 Bacteria 45433
3 JGI25153J46596_10008210 3300003215 Bacteria 5022
4 JGI25153J46596_10014105 3300003215 Bacteria 3340
5 rootH1_10071059 3300003316 Bacteria 4550
6 rootH1_10156253 3300003316 Bacteria 1501
7 rootH2_10077862 3300003320 Bacteria 7285
8 rootH2_10107991 3300003320 Bacteria 3547
9 rootH2_10246147 3300003320 Bacteria 2470
10 rootH2_10301267 3300003320 Bacteria 1883
11 rootL2_10011990 3300003322 Bacteria 2293
12 rootL2_10016026 3300003322 Bacteria 9708
13 rootL2_10111424 3300003322 Bacteria 1771
14 rootL2_10249239 3300003322 Bacteria 1316
15 rootL2_10250835 3300003322 Bacteria 2319
16 rootL2_10256841 3300003322 Bacteria 3464
17 rootH1_10108072 3300003323 Unclassified 1349
18 JGI25160J50197_1005223 3300003354 Bacteria 5442
19 Ga0055542_1001954 3300003762 Bacteria 8019
20 Ga0055526_1014238 3300003771 Bacteria 3287
21 Ga0055526_1018254 3300003771 Bacteria 2627
22 Ga0055528_1000120 3300003790 Bacteria 62209
23 Ga0055531_10000326 3300003794 Bacteria 47005
24 Ga0055531_10040540 3300003794 Bacteria 1363
25 Ga0055543_1009369 3300004625 Bacteria 2108
26 Ga0065165_1000012 3300005262 Bacteria 303241
27 Ga0065165_1074052 3300005262 Unclassified 898
28 Ga0065714_10002590 3300005288 Bacteria 13911
29 Ga0065714_10155516 3300005288 Bacteria 1081
30 Ga0070683_100003363 3300005329 Bacteria 12959
31 Ga0070684_100043923 3300005535 Bacteria 3862
32 Ga0068855_102109456 3300005563 Unclassified 567
33 Ga0105241_10585913 3300009174 Bacteria 1006
34 Ga0105239_10002611 3300010375 Bacteria 22800
35 Ga0105239_10149599 3300010375 Bacteria 2605
36 Ga0157373_10231555 3300013100 Bacteria 1305
37 Ga0157371_10396209 3300013102 Unclassified 1010
38 Ga0157369_11367352 3300013105 Bacteria 721
39 Ga0157372_10807237 3300013307 Unclassified 1090
40 Ga0182008_10000029 3300014497 Bacteria 176649
41 Ga0209437_100030 3300025233 Bacteria 532466
42 Ga0209258_100303 3300025242 Bacteria 79506
43 Ga0209646_1010654 3300025246 Bacteria 1437
44 Ga0209148_1000329 3300025254 Bacteria 65492
45 Ga0209129_1017455 3300025258 Bacteria 1407
46 Ga0209673_1000016 3300025273 Bacteria 506202
47 Ga0209673_1000111 3300025273 Bacteria 180094
48 Ga0209564_1000921 3300025295 Bacteria 38293
49 Ga0209564_1001737 3300025295 Bacteria 20427
50 Ga0209758_1001215 3300025297 Bacteria 32372
51 Ga0209758_1001338 3300025297 Bacteria 29806
52 Ga0209758_1001631 3300025297 Bacteria 25504
53 Ga0209758_1011116 3300025297 Bacteria 5260
54 Ga0209050_1005540 3300025298 Bacteria 7885
55 Ga0207426_1000793 3300025302 Bacteria 34331
56 Ga0207426_1004544 3300025302 Bacteria 6712
57 Ga0207426_1010787 3300025302 Bacteria 3527
58 Ga0209257_1000013 3300025304 Bacteria 1047305
59 Ga0209257_1004716 3300025304 Bacteria 10225
60 Ga0207661_10004142 3300025944 Bacteria 10137
61 Ga0307408_100001598 3300031548 Bacteria 16745
62 Ga0307413_10005817 3300031824 Bacteria 5555
63 Ga0307410_10001425 3300031852 Bacteria 10763
64 Ga0307412_10000018 3300031911 Bacteria 284374
65 Ga0307414_10000002 3300032004 Bacteria 623006
66 Ga0307414_10000267 3300032004 Bacteria 32791
67 Ga0395905_0720427 3300037471 Unclassified 900
68 Ga0439466_0204439 3300041411 Bacteria 600
69 Ga0451853_1423732 3300041512 Bacteria 711
70 Ga0466972_0025289 3300044658 Bacteria 2944
71 Ga0466965_0110178 3300044683 Bacteria 1414
72 Ga0495606_0009350 3300046507 Bacteria 8304
73 Ga0495606_0020025 3300046507 Bacteria 4950
74 Ga0495610_0000001 3300046512 Bacteria 1620061
75 Ga0495610_0002030 3300046512 Bacteria 17317
76 Ga0495637_0063319 3300046520 Bacteria 1512
77 Ga0495672_0018639 3300047320 Bacteria 4599
78 Ga0496101_0623559 3300048904 Bacteria 852
79 Ga0496121_0000007 3300048924 Bacteria 942516
80 Ga0496122_0015694 3300048925 Bacteria 7223
81 Ga0496126_0020005 3300048929 Bacteria 6575
82 Ga0501230_043012 3300049667 Bacteria 880
83 Ga0501238_003029 3300049671 Bacteria 2050
84 Ga0501259_076811 3300049688 Bacteria 727
85 Ga0501219_000291 3300049703 Bacteria 8885
86 Ga0501280_008884 3300049776 Bacteria 1398
87 Ga0501284_00098 3300050005 Bacteria 18256
88 Ga0500644_0000048 3300053088 Bacteria 73311
89 Ga0500646_0005099 3300053090 Bacteria 3328
90 Ga0500583_0029074 3300053092 Bacteria 2405
91 Ga0500569_000377 3300053109 Bacteria 7261
92 Ga0500594_0026084 3300053118 Unclassified 1503
93 Ga0500607_109731 3300053121 Unclassified 1355
94 Ga0500642_0159203 3300053130 Bacteria 1059
95 Ga0500658_0006155 3300053134 Bacteria 4466
96 Ga0500559_0031144 3300053136 Unclassified 2288
97 Ga0500561_0059673 3300053137 Bacteria 1065
98 Ga0500577_0098584 3300053142 Bacteria 1191
99 Ga0500589_068212 3300053147 Bacteria 1615
100 Ga0500604_0008679 3300053151 Bacteria 2699
101 Ga0500616_0017395 3300053153 Bacteria 4078
102 Ga0500622_0000026 3300053156 Bacteria 235660
103 Ga0500622_0000267 3300053156 Bacteria 53425
104 Ga0500622_0008277 3300053156 Bacteria 5833
105 Ga0500633_0011496 3300053160 Bacteria 2410
106 Ga0500634_0063561 3300053161 Bacteria 1952
107 Ga0500636_0079161 3300053177 Unclassified 1896

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053090 Ga0500646_0005099 Ga0500646_0005099_1082_1543 116
2 3300053109 Ga0500569_000377 Ga0500569_000377_1823_2284 116
3 3300053134 Ga0500658_0006155 Ga0500658_0006155_2245_2706 116
4 3300053142 Ga0500577_0098584 Ga0500577_0098584_335_796 116
5 3300053153 Ga0500616_0017395 Ga0500616_0017395_2010_2471 116
6 3300053088 Ga0500644_0000048 Ga0500644_0000048_71243_71707 129
7 3300053137 Ga0500561_0059673 Ga0500561_0059673_68_532 129
8 3300053160 Ga0500633_0011496 Ga0500633_0011496_1194_1658 129
9 3300053161 Ga0500634_0063561 Ga0500634_0063561_1139_1603 129
10 3300003322 rootL2_10256841 rootL2_102568412 133
11 3300003323 rootH1_10108072 rootH1_101080723 137
12 3300044658 Ga0466972_0025289 Ga0466972_0025289_1150_1614 137
13 3300014497 Ga0182008_10000029 Ga0182008_1000002940 138
14 3300003215 JGI25153J46596_10014105 JGI25153J46596_100141053 139
15 3300003771 Ga0055526_1014238 Ga0055526_10142382 139
16 3300003771 Ga0055526_1018254 Ga0055526_10182543 139
17 3300004625 Ga0055543_1009369 Ga0055543_10093693 139
18 3300005329 Ga0070683_100003363 Ga0070683_1000033635 139
19 3300005535 Ga0070684_100043923 Ga0070684_1000439236 139
20 3300013100 Ga0157373_10231555 Ga0157373_102315551 139
21 3300013102 Ga0157371_10396209 Ga0157371_103962092 139
22 3300025295 Ga0209564_1000921 Ga0209564_100092121 139
23 3300025297 Ga0209758_1001338 Ga0209758_100133815 139
24 3300025944 Ga0207661_10004142 Ga0207661_100041426 139
25 3300044683 Ga0466965_0110178 Ga0466965_0110178_712_1131 139
26 3300049703 Ga0501219_000291 Ga0501219_000291_8287_8748 139
27 3300050005 Ga0501284_00098 Ga0501284_00098_17467_17928 139
28 3300053092 Ga0500583_0029074 Ga0500583_0029074_1784_2245 139
29 3300053121 Ga0500607_109731 Ga0500607_109731_415_879 139
30 3300053147 Ga0500589_068212 Ga0500589_068212_891_1352 139
31 3300003316 rootH1_10156253 rootH1_101562531 140
32 3300005563 Ga0068855_102109456 Ga0068855_1021094562 140
33 3300010375 Ga0105239_10149599 Ga0105239_101495994 140
34 3300046507 Ga0495606_0009350 Ga0495606_0009350_3228_3650 140
35 3300053136 Ga0500559_0031144 Ga0500559_0031144_88_552 140
36 3300053156 Ga0500622_0008277 Ga0500622_0008277_292_714 140
37 3300053177 Ga0500636_0079161 Ga0500636_0079161_1354_1818 140
38 iso_pu_bacteria 2896344016 2896344768 140
39 3300041411 Ga0439466_0204439 Ga0439466_0204439_27_485 141
40 3300003320 rootH2_10301267 rootH2_103012673 142
41 3300003794 Ga0055531_10000326 Ga0055531_1000032632 142
42 3300049667 Ga0501230_043012 Ga0501230_043012_312_740 142
43 3300047320 Ga0495672_0018639 Ga0495672_0018639_3619_4083 143
44 3300031852 Ga0307410_10001425 Ga0307410_100014257 145
45 3300049776 Ga0501280_008884 Ga0501280_008884_588_1046 145
46 iso_pu_bacteria 2929177148 2929177252 146
47 3300003322 rootL2_10111424 rootL2_101114243 147
48 iso_pu_bacteria 2958512119 2958513877 147
49 iso_pu_bacteria 2585428184 2588219885 148
50 iso_pu_bacteria 2881955468 2881955589 148
51 iso_pu_bacteria 2903895155 2903898396 148
52 iso_pu_bacteria 2905999023 2906000744 148
53 iso_pu_bacteria 2945924605 2945927234 148
54 iso_pu_bacteria 2993480792 2993484592 148
55 iso_pu_bacteria 8055592153 8055594346 148
56 3300003320 rootH2_10246147 rootH2_102461474 150
57 3300049688 Ga0501259_076811 Ga0501259_076811_197_649 150
58 iso_pu_bacteria 2852623160 2852625430 150
59 iso_pu_bacteria 2929921140 2929924247 150
60 iso_pu_bacteria 8003151029 8003156107 150
61 3300003762 Ga0055542_1001954 Ga0055542_10019546 152
62 3300013307 Ga0157372_10807237 Ga0157372_108072372 152
63 3300025242 Ga0209258_100303 Ga0209258_10030333 152
64 3300025246 Ga0209646_1010654 Ga0209646_10106542 152
65 3300025254 Ga0209148_1000329 Ga0209148_100032916 152
66 3300031548 Ga0307408_100001598 Ga0307408_10000159812 152
67 3300031824 Ga0307413_10005817 Ga0307413_100058175 152
68 3300032004 Ga0307414_10000002 Ga0307414_10000002226 152
69 3300041512 Ga0451853_1423732 Ga0451853_1423732_114_596 152
70 3300046512 Ga0495610_0000001 Ga0495610_0000001_1515533_1515991 152
71 3300048925 Ga0496122_0015694 Ga0496122_0015694_622_1080 152
72 3300053118 Ga0500594_0026084 Ga0500594_0026084_690_1148 152
73 3300002737 JGI25162J39368_1000301 JGI25162J39368_100030115 153
74 3300005288 Ga0065714_10002590 Ga0065714_100025902 153
75 3300010375 Ga0105239_10002611 Ga0105239_100026117 153
76 3300025233 Ga0209437_100030 Ga0209437_100030400 153
77 3300025258 Ga0209129_1017455 Ga0209129_10174552 153
78 3300031911 Ga0307412_10000018 Ga0307412_10000018121 153
79 3300032004 Ga0307414_10000267 Ga0307414_100002676 153
80 3300001989 JGI24739J22299_10002722 JGI24739J22299_100027224 154
81 3300003215 JGI25153J46596_10008210 JGI25153J46596_100082103 154
82 3300003316 rootH1_10071059 rootH1_100710592 154
83 3300003320 rootH2_10077862 rootH2_100778625 154
84 3300003320 rootH2_10107991 rootH2_101079917 154
85 3300003322 rootL2_10011990 rootL2_100119904 154
86 3300003322 rootL2_10016026 rootL2_100160266 154
87 3300003322 rootL2_10249239 rootL2_102492392 154
88 3300003322 rootL2_10250835 rootL2_102508354 154
89 3300003354 JGI25160J50197_1005223 JGI25160J50197_10052234 154
90 3300003790 Ga0055528_1000120 Ga0055528_100012019 154
91 3300003794 Ga0055531_10040540 Ga0055531_100405402 154
92 3300005262 Ga0065165_1000012 Ga0065165_1000012236 154
93 3300005262 Ga0065165_1074052 Ga0065165_10740522 154
94 3300005288 Ga0065714_10155516 Ga0065714_101555162 154
95 3300009174 Ga0105241_10585913 Ga0105241_105859131 154
96 3300013105 Ga0157369_11367352 Ga0157369_113673521 154
97 3300025273 Ga0209673_1000016 Ga0209673_1000016334 154
98 3300025273 Ga0209673_1000111 Ga0209673_1000111110 154
99 3300025295 Ga0209564_1001737 Ga0209564_100173714 154
100 3300025297 Ga0209758_1001215 Ga0209758_10012155 154
101 3300025297 Ga0209758_1001631 Ga0209758_10016317 154
102 3300025297 Ga0209758_1011116 Ga0209758_10111164 154
103 3300025298 Ga0209050_1005540 Ga0209050_10055406 154
104 3300025302 Ga0207426_1000793 Ga0207426_10007933 154
105 3300025302 Ga0207426_1004544 Ga0207426_10045443 154
106 3300025302 Ga0207426_1010787 Ga0207426_10107874 154
107 3300025304 Ga0209257_1000013 Ga0209257_1000013172 154
108 3300025304 Ga0209257_1004716 Ga0209257_10047166 154
109 3300037471 Ga0395905_0720427 Ga0395905_0720427_377_847 154
110 3300046507 Ga0495606_0020025 Ga0495606_0020025_2285_2755 154
111 3300046512 Ga0495610_0002030 Ga0495610_0002030_7363_7827 154
112 3300046520 Ga0495637_0063319 Ga0495637_0063319_760_1224 154
113 3300048904 Ga0496101_0623559 Ga0496101_0623559_270_734 154
114 3300048924 Ga0496121_0000007 Ga0496121_0000007_367174_367638 154
115 3300048929 Ga0496126_0020005 Ga0496126_0020005_999_1463 154
116 3300049671 Ga0501238_003029 Ga0501238_003029_772_1236 154
117 3300053130 Ga0500642_0159203 Ga0500642_0159203_573_1037 154
118 3300053151 Ga0500604_0008679 Ga0500604_0008679_197_661 154
119 3300053156 Ga0500622_0000026 Ga0500622_0000026_25439_25903 154
120 3300053156 Ga0500622_0000267 Ga0500622_0000267_15324_15788 154

Structural Annotation

Top 5 Hits

ID Description Score Start End
6adq-assembly1.cif.gz_S respiratory complex ciii2civ2sod2 from mycobacterium smegmatis 0.6917 5 152
3t6g-assembly2.cif.gz_D structure of the complex between nsp3 (shep1) and p130cas 0.6231 4 147
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.6199 9 139
6adq-assembly1.cif.gz_S respiratory complex ciii2civ2sod2 from mycobacterium smegmatis 0.6162 5 152
2lfd-assembly1.cif.gz_A solution nmr structure of diiron protein in presence of 2 eq zn2+, northeast structural genomics consortium target or21 0.6159 8 139
ID Description Score Start End Superfamily
af_P9WJU7_501_915_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.6367 2 147 1.20.1640.10
af_P24891_68_255_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.6265 9 138 1.20.120.80
af_P0CE94_738_858_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6203 9 137 1.20.120.230
af_A0A0R4IDZ8_1844_1969_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.6124 1 137 3.10.20.90
af_I1JJR6_181_383_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6121 3 146 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A142HEJ8-F1-model_v4 deleted 0.9831 17 140
AF-A0A3D4CJ96-F1-model_v4 Cytochrome B 0.9811 2 140 GO:0016020
AF-A0A3B9ZRL0-F1-model_v4 Cytochrome B 0.978 35 140 GO:0016020
AF-A0A1P8KLF6-F1-model_v4 Cytochrome B 0.9764 5 140 GO:0016020
AF-A0A7V4YUQ8-F1-model_v4 Cytochrome B 0.973 1 138 GO:0016020

Feature Viewer

pLDDT pTM Quality
90.74 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map