F102976

General Info

Members Datasets Scaffolds Average Seq Length
119 93 113 185

Family's Representative Sequence

Representative Sequence 3300046515|Ga0495620_0003929|Ga0495620_0003929_4705_5340
Length 211
Sequence MKNKIRSCNNSKVRGVGMANFNKTKIDGVYIIEPKVFGDNRGYFMETYNKEHFAEAGLNMTFVQDNESKSSKGVLRGLHFQRKHSQGKLVRVTKGEVFDVAVDLRNGSKTYGKWEGIILSEENKKQFYIPEGFAHGFLVLSDEAVFNYKCTELYAPEYDGGVMWNDPDINIEWPLDVIENVLLSEKDKNHSSLKELDLSEYSDFNICLKEV

Samples

Sample ID Description Type Environment
1 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
2 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
3 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
4 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
24 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
30 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
36 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
46 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
55 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
56 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
57 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
58 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
59 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
60 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
61 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
62 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
63 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
64 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
65 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
66 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
67 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
68 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
69 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
70 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
71 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
72 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
73 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
74 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
75 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
76 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
77 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
78 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
79 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
80 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
81 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
82 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
83 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
84 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
85 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
89 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
90 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
91 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
92 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
93 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.96
Metatranscriptomes 0
Isolates 5.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.13
Nodule 15.13
Rhizoplane 0.84
Rhizosphere 42.86
Stem 0
Stem Tuber 0
Unclassified 26.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000614 3300003187 Bacteria 31207
2 JGI25153J46596_10086002 3300003215 Unclassified 771
3 rootL2_10112398 3300003322 Bacteria 3029
4 Ga0055526_1002277 3300003771 Bacteria 13115
5 Ga0055524_1000196 3300003775 Bacteria 66415
6 Ga0055524_1004096 3300003775 Bacteria 6840
7 Ga0055534_1000270 3300003784 Bacteria 35440
8 Ga0070689_100483856 3300005340 Bacteria 1058
9 Ga0070709_10000428 3300005434 Bacteria 25505
10 Ga0070714_100029490 3300005435 Bacteria 4561
11 Ga0070710_10003920 3300005437 Bacteria 7050
12 Ga0070711_100000192 3300005439 Bacteria 32464
13 Ga0070695_101003170 3300005545 Bacteria 679
14 Ga0070664_100964891 3300005564 Unclassified 801
15 Ga0070717_10035930 3300006028 Unclassified 4016
16 Ga0070715_10061314 3300006163 Unclassified 1651
17 Ga0070716_100000307 3300006173 Bacteria 19740
18 Ga0070712_100013457 3300006175 Bacteria 5229
19 Ga0068871_100477356 3300006358 Bacteria 1121
20 Ga0079104_1000246 3300006946 Bacteria 72294
21 Ga0079104_1000952 3300006946 Bacteria 22829
22 Ga0079104_1001858 3300006946 Bacteria 12811
23 Ga0079104_1004507 3300006946 Bacteria 5921
24 Ga0079104_1007599 3300006946 Bacteria 3897
25 Ga0079104_1014989 3300006946 Bacteria 2316
26 Ga0079104_1038953 3300006946 Bacteria 1123
27 Ga0099826_10000003 3300006948 Bacteria 1067817
28 Ga0105245_10770395 3300009098 Bacteria 999
29 Ga0105247_10900982 3300009101 Bacteria 683
30 Ga0157371_10782014 3300013102 Bacteria 718
31 Ga0157378_10130734 3300013297 Bacteria 2324
32 Ga0209233_1009152 3300025261 Bacteria 3027
33 Ga0209565_1000368 3300025263 Bacteria 38635
34 Ga0209673_1025101 3300025273 Bacteria 1988
35 Ga0209675_1000383 3300025291 Bacteria 36811
36 Ga0209025_1001088 3300025294 Bacteria 39306
37 Ga0209564_1000497 3300025295 Bacteria 64942
38 Ga0209758_1032572 3300025297 Bacteria 2112
39 Ga0209256_1000059 3300025299 Bacteria 272170
40 Ga0209256_1000842 3300025299 Bacteria 38479
41 Ga0207692_10000479 3300025898 Bacteria 14111
42 Ga0207685_10007891 3300025905 Unclassified 2998
43 Ga0207699_10000457 3300025906 Bacteria 20857
44 Ga0207693_10006300 3300025915 Bacteria 9844
45 Ga0207663_10000554 3300025916 Bacteria 16491
46 Ga0207664_10052026 3300025929 Bacteria 3237
47 Ga0207665_10002782 3300025939 Bacteria 11723
48 Ga0207679_10173345 3300025945 Bacteria 1778
49 Ga0209281_1000052 3300027111 Bacteria 314741
50 Ga0209281_1000088 3300027111 Bacteria 245908
51 Ga0209281_1000235 3300027111 Bacteria 115011
52 Ga0209281_1000658 3300027111 Bacteria 36963
53 Ga0209281_1001016 3300027111 Bacteria 21896
54 Ga0209281_1001383 3300027111 Bacteria 14843
55 Ga0209281_1009312 3300027111 Bacteria 2313
56 Ga0209281_1027058 3300027111 Bacteria 1054
57 Ga0209371_1004478 3300027312 Bacteria 6042
58 Ga0209282_1000002 3300027666 Bacteria 1067825
59 Ga0268264_11816422 3300028381 Bacteria 620
60 Ga0265324_10017343 3300029957 Bacteria 2619
61 Ga0268256_1003839 3300030500 Bacteria 6549
62 Ga0307409_100000516 3300031995 Bacteria 16672
63 Ga0316584_0167930 3300036712 Bacteria 1629
64 Ga0395905_0033023 3300037471 Bacteria 4865
65 Ga0400484_30076 3300038725 Bacteria 35005
66 Ga0400490_22244 3300038726 Bacteria 2192
67 Ga0400490_54931 3300038726 Bacteria 1144
68 Ga0400485_01922 3300038735 Bacteria 62762
69 Ga0400486_23232 3300038742 Bacteria 285561
70 Ga0400483_275463 3300039062 Bacteria 4874
71 Ga0400487_56197 3300039110 Bacteria 40143
72 Ga0451855_0316490 3300041511 Unclassified 1153
73 Ga0451855_1128258 3300041511 Bacteria 2047
74 Ga0451855_1201061 3300041511 Bacteria 982
75 Ga0451855_1481413 3300041511 Bacteria 1155
76 Ga0451855_1717331 3300041511 Bacteria 860
77 Ga0451855_1730344 3300041511 Bacteria 1626
78 Ga0495653_0028056 3300046463 Bacteria 4505
79 Ga0495607_0169551 3300046501 Bacteria 1103
80 Ga0495583_0010544 3300046506 Bacteria 5378
81 Ga0495606_0002040 3300046507 Bacteria 24738
82 Ga0495616_0027739 3300046513 Bacteria 3002
83 Ga0495620_0003929 3300046515 Bacteria 8468
84 Ga0495620_0047176 3300046515 Bacteria 1856
85 Ga0495654_0244383 3300046530 Bacteria 750
86 Ga0495609_0161922 3300046538 Bacteria 948
87 Ga0495597_0089940 3300046542 Bacteria 1304
88 Ga0495668_0001925 3300046616 Bacteria 18451
89 Ga0495671_0155413 3300046692 Bacteria 1113
90 Ga0495649_0079432 3300046694 Bacteria 1755
91 Ga0495660_0020531 3300046810 Bacteria 3786
92 Ga0495672_0046986 3300047320 Bacteria 2571
93 Ga0495679_002719 3300047446 Bacteria 8816
94 Ga0495626_0059953 3300048091 Bacteria 1735
95 Ga0496112_0503673 3300048915 Bacteria 1146
96 Ga0496116_0000110 3300048919 Bacteria 185668
97 Ga0496119_0002746 3300048922 Bacteria 18944
98 Ga0496120_0003354 3300048923 Bacteria 14693
99 Ga0496121_0362250 3300048924 Bacteria 962
100 Ga0496122_0000027 3300048925 Bacteria 350764
101 Ga0496122_0013653 3300048925 Bacteria 7928
102 Ga0496123_0065019 3300048926 Bacteria 2321
103 Ga0496124_0000045 3300048927 Bacteria 287396
104 Ga0496124_0020714 3300048927 Bacteria 6069
105 Ga0496125_0097462 3300048928 Bacteria 2179
106 Ga0496126_0000214 3300048929 Bacteria 127811
107 Ga0496126_0000720 3300048929 Bacteria 60125
108 Ga0496126_0000909 3300048929 Bacteria 51172
109 Ga0501076_1007846 3300049592 Bacteria 686
110 Ga0501238_003672 3300049671 Bacteria 1894
111 Ga0500608_048221 3300053122 Bacteria 2046
112 Ga0500618_000735 3300053125 Bacteria 18723
113 Ga0500636_0074584 3300053177 Bacteria 1963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038735 Ga0400485_01922 Ga0400485_01922_42481_43059 165
2 3300038742 Ga0400486_23232 Ga0400486_23232_64133_64711 165
3 3300039110 Ga0400487_56197 Ga0400487_56197_16021_16599 165
4 3300048928 Ga0496125_0097462 Ga0496125_0097462_535_1059 167
5 iso_pu_bacteria 2919534386 2919537082 175
6 iso_pu_bacteria 2919688452 2919688686 175
7 3300048919 Ga0496116_0000110 Ga0496116_0000110_24974_25513 177
8 iso_pu_bacteria 2891670763 2891672143 179
9 iso_pu_bacteria 2919160200 2919165155 179
10 iso_pu_bacteria 644736347 644748703 179
11 3300005340 Ga0070689_100483856 Ga0070689_1004838562 180
12 3300005564 Ga0070664_100964891 Ga0070664_1009648912 180
13 3300006946 Ga0079104_1000952 Ga0079104_100095211 180
14 3300009098 Ga0105245_10770395 Ga0105245_107703952 180
15 3300025945 Ga0207679_10173345 Ga0207679_101733452 180
16 3300027111 Ga0209281_1001016 Ga0209281_100101611 180
17 3300031995 Ga0307409_100000516 Ga0307409_1000005165 180
18 3300036712 Ga0316584_0167930 Ga0316584_0167930_167_709 180
19 3300038725 Ga0400484_30076 Ga0400484_30076_12951_13493 180
20 3300041511 Ga0451855_0316490 Ga0451855_0316490_91_639 180
21 3300041511 Ga0451855_1128258 Ga0451855_1128258_1150_1698 180
22 3300041511 Ga0451855_1481413 Ga0451855_1481413_311_859 180
23 3300041511 Ga0451855_1717331 Ga0451855_1717331_33_581 180
24 3300041511 Ga0451855_1730344 Ga0451855_1730344_1052_1600 180
25 3300048922 Ga0496119_0002746 Ga0496119_0002746_12437_12994 180
26 3300048923 Ga0496120_0003354 Ga0496120_0003354_4191_4748 180
27 3300048929 Ga0496126_0000909 Ga0496126_0000909_7063_7617 180
28 3300049592 Ga0501076_1007846 Ga0501076_1007846_59_601 180
29 3300005545 Ga0070695_101003170 Ga0070695_1010031701 181
30 3300006358 Ga0068871_100477356 Ga0068871_1004773562 181
31 3300006948 Ga0099826_10000003 Ga0099826_10000003549 181
32 3300025261 Ga0209233_1009152 Ga0209233_10091524 181
33 3300027666 Ga0209282_1000002 Ga0209282_1000002449 181
34 3300029957 Ga0265324_10017343 Ga0265324_100173433 181
35 3300046463 Ga0495653_0028056 Ga0495653_0028056_1093_1638 181
36 3300046507 Ga0495606_0002040 Ga0495606_0002040_9420_9965 181
37 3300048924 Ga0496121_0362250 Ga0496121_0362250_104_649 181
38 3300048927 Ga0496124_0020714 Ga0496124_0020714_5284_5829 181
39 3300049671 Ga0501238_003672 Ga0501238_003672_1199_1744 181
40 3300053122 Ga0500608_048221 Ga0500608_048221_1058_1603 181
41 3300053125 Ga0500618_000735 Ga0500618_000735_12803_13348 181
42 iso_pu_bacteria 8007371054 8007374660 182
43 3300003775 Ga0055524_1004096 Ga0055524_10040966 183
44 3300005434 Ga0070709_10000428 Ga0070709_100004284 183
45 3300005435 Ga0070714_100029490 Ga0070714_1000294904 183
46 3300005437 Ga0070710_10003920 Ga0070710_100039206 183
47 3300005439 Ga0070711_100000192 Ga0070711_10000019213 183
48 3300006028 Ga0070717_10035930 Ga0070717_100359304 183
49 3300006163 Ga0070715_10061314 Ga0070715_100613142 183
50 3300006173 Ga0070716_100000307 Ga0070716_1000003073 183
51 3300006175 Ga0070712_100013457 Ga0070712_1000134573 183
52 3300009101 Ga0105247_10900982 Ga0105247_109009821 183
53 3300013297 Ga0157378_10130734 Ga0157378_101307342 183
54 3300025299 Ga0209256_1000842 Ga0209256_10008428 183
55 3300025898 Ga0207692_10000479 Ga0207692_1000047910 183
56 3300025905 Ga0207685_10007891 Ga0207685_100078914 183
57 3300025906 Ga0207699_10000457 Ga0207699_100004574 183
58 3300025915 Ga0207693_10006300 Ga0207693_100063006 183
59 3300025916 Ga0207663_10000554 Ga0207663_100005548 183
60 3300025929 Ga0207664_10052026 Ga0207664_100520263 183
61 3300025939 Ga0207665_10002782 Ga0207665_1000278211 183
62 3300028381 Ga0268264_11816422 Ga0268264_118164221 183
63 3300038726 Ga0400490_22244 Ga0400490_22244_691_1248 183
64 3300038726 Ga0400490_54931 Ga0400490_54931_179_736 183
65 3300039062 Ga0400483_275463 Ga0400483_275463_3757_4314 183
66 3300046501 Ga0495607_0169551 Ga0495607_0169551_411_962 183
67 3300046506 Ga0495583_0010544 Ga0495583_0010544_2637_3188 183
68 3300046513 Ga0495616_0027739 Ga0495616_0027739_1618_2169 183
69 3300046530 Ga0495654_0244383 Ga0495654_0244383_152_703 183
70 3300046538 Ga0495609_0161922 Ga0495609_0161922_346_897 183
71 3300046542 Ga0495597_0089940 Ga0495597_0089940_492_1043 183
72 3300046616 Ga0495668_0001925 Ga0495668_0001925_13300_13851 183
73 3300046692 Ga0495671_0155413 Ga0495671_0155413_120_671 183
74 3300046810 Ga0495660_0020531 Ga0495660_0020531_2931_3482 183
75 3300047446 Ga0495679_002719 Ga0495679_002719_1707_2258 183
76 3300048091 Ga0495626_0059953 Ga0495626_0059953_635_1186 183
77 3300053177 Ga0500636_0074584 Ga0500636_0074584_1262_1816 183
78 3300006946 Ga0079104_1038953 Ga0079104_10389532 184
79 3300013102 Ga0157371_10782014 Ga0157371_107820141 184
80 3300027111 Ga0209281_1027058 Ga0209281_10270582 184
81 3300048925 Ga0496122_0013653 Ga0496122_0013653_298_855 184
82 3300048927 Ga0496124_0000045 Ga0496124_0000045_191094_191651 184
83 3300046515 Ga0495620_0047176 Ga0495620_0047176_1204_1791 185
84 3300047320 Ga0495672_0046986 Ga0495672_0046986_471_1058 185
85 3300003322 rootL2_10112398 rootL2_101123983 186
86 3300041511 Ga0451855_1201061 Ga0451855_1201061_332_922 186
87 3300006946 Ga0079104_1000246 Ga0079104_100024626 187
88 3300006946 Ga0079104_1001858 Ga0079104_10018583 187
89 3300006946 Ga0079104_1004507 Ga0079104_10045075 187
90 3300006946 Ga0079104_1007599 Ga0079104_10075994 187
91 3300006946 Ga0079104_1014989 Ga0079104_10149892 187
92 3300027111 Ga0209281_1000052 Ga0209281_1000052261 187
93 3300027111 Ga0209281_1000088 Ga0209281_1000088172 187
94 3300027111 Ga0209281_1000235 Ga0209281_100023578 187
95 3300027111 Ga0209281_1000658 Ga0209281_100065821 187
96 3300027111 Ga0209281_1001383 Ga0209281_10013836 187
97 3300027111 Ga0209281_1009312 Ga0209281_10093122 187
98 3300027312 Ga0209371_1004478 Ga0209371_10044788 187
99 3300030500 Ga0268256_1003839 Ga0268256_10038392 187
100 3300037471 Ga0395905_0033023 Ga0395905_0033023_205_780 187
101 3300046694 Ga0495649_0079432 Ga0495649_0079432_193_756 187
102 3300048915 Ga0496112_0503673 Ga0496112_0503673_204_767 187
103 3300048925 Ga0496122_0000027 Ga0496122_0000027_204394_204984 187
104 3300048926 Ga0496123_0065019 Ga0496123_0065019_162_752 187
105 3300048929 Ga0496126_0000214 Ga0496126_0000214_32056_32646 187
106 3300048929 Ga0496126_0000720 Ga0496126_0000720_50840_51430 187
107 3300046515 Ga0495620_0003929 Ga0495620_0003929_4705_5340 190
108 3300003187 JGI25151J46595_10000614 JGI25151J46595_100006146 191
109 3300003215 JGI25153J46596_10086002 JGI25153J46596_100860022 191
110 3300003771 Ga0055526_1002277 Ga0055526_10022775 191
111 3300003775 Ga0055524_1000196 Ga0055524_100019632 191
112 3300003784 Ga0055534_1000270 Ga0055534_100027026 191
113 3300025263 Ga0209565_1000368 Ga0209565_100036832 191
114 3300025273 Ga0209673_1025101 Ga0209673_10251012 191
115 3300025291 Ga0209675_1000383 Ga0209675_100038326 191
116 3300025294 Ga0209025_1001088 Ga0209025_100108812 191
117 3300025295 Ga0209564_1000497 Ga0209564_100049732 191
118 3300025297 Ga0209758_1032572 Ga0209758_10325722 191
119 3300025299 Ga0209256_1000059 Ga0209256_1000059208 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

23

195

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.9758 7 190
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9743 5 185
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9736 6 185
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.9714 6 185
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9703 7 181
ID Description Score Start End Superfamily
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9674 5 185 2.60.120.10
af_Q17993_17_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9532 13 183 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9519 5 185 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9497 8 182 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9492 9 182 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A5C7VRA9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9957 8 156 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-T2JAF3-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9927 8 142 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A6L5DM26-F1-model_v4 deleted 0.9916 6 185
AF-Q93JU1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.991 8 185 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A6P0Z7Y0-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.991 8 164 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
94.65 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map