F102975

General Info

Members Datasets Scaffolds Average Seq Length
119 78 238 262

Family's Representative Sequence

Representative Sequence 3300046514|Ga0495618_0268276|Ga0495618_0268276_202_1053
Length 283
Sequence MQVEDCRAGFYLLTFDIGRFDNVMKFSLKNKWVLITGASSGFGAAAARSFGAEGAKLLLGARRVDRLEKVAAQAKKAGAGEAHFHFLDVASTASVETFFAWAKTKLKSKPLHVLINNAGGALGVDTVAEGKDDDWEAMIQSNVLGVLRVTRAALPLIPRDAGASIINIGSLAGRRFYAGSAVYCAAKAGELQLTRVLRQELFGSGIRVSSIDPGLAETEFARVRFKGDAKKAKELYEGANPLVAADIAEILVWVATRPPHVNIDEMLIKPVDQADIGKVFKRK

Samples

Sample ID Description Type Environment
1 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
15 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
30 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
31 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
32 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
33 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
34 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
35 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
38 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
44 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
45 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
46 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
47 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
48 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
49 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
50 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
51 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
52 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
53 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
54 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
55 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
56 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
57 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
58 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
59 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
60 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
61 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
62 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
63 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
64 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
65 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
66 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
67 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
68 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
69 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
71 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
72 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
73 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
74 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
75 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
76 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
77 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
78 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 0
Rhizosphere 98.32
Stem 0
Stem Tuber 0
Unclassified 11.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495618_0268276 3300046514 Bacteria 1067
2 rootH2_10294440 3300003320 Bacteria 2263
3 Ga0070676_10178872 3300005328 Bacteria 1377
4 Ga0070690_100217894 3300005330 Bacteria 1336
5 Ga0070690_100283780 3300005330 Bacteria 1182
6 Ga0070713_100130183 3300005436 Unclassified 2218
7 Ga0070701_10008436 3300005438 Bacteria 4458
8 Ga0070705_100076336 3300005440 Bacteria 2043
9 Ga0070694_100002991 3300005444 Bacteria 10046
10 Ga0068867_100345940 3300005459 Unclassified 1239
11 Ga0070704_100026905 3300005549 Bacteria 3807
12 Ga0068856_100000751 3300005614 Bacteria 35216
13 Ga0068856_100054105 3300005614 Bacteria 3958
14 Ga0068858_100067378 3300005842 Bacteria 3316
15 Ga0075428_100001336 3300006844 Bacteria 26156
16 Ga0075436_100140315 3300006914 Bacteria 1698
17 Ga0075435_100093624 3300007076 Bacteria 2483
18 Ga0105240_10048949 3300009093 Bacteria 5339
19 Ga0111539_10024401 3300009094 Bacteria 7421
20 Ga0114129_10756315 3300009147 Bacteria 1244
21 Ga0114129_11015849 3300009147 Bacteria 1043
22 Ga0105248_10811205 3300009177 Unclassified 1056
23 Ga0105238_10001107 3300009551 Bacteria 27230
24 Ga0105238_10490044 3300009551 Bacteria 1229
25 Ga0157378_10505542 3300013297 Bacteria 1208
26 Ga0157375_10000006 3300013308 Bacteria 384086
27 Ga0163163_10000083 3300014325 Bacteria 104503
28 Ga0157380_10721043 3300014326 Bacteria 1005
29 Ga0207680_10549090 3300025903 Unclassified 825
30 Ga0207694_10002636 3300025924 Bacteria 14541
31 Ga0207694_10335413 3300025924 Bacteria 1250
32 Ga0207700_10089740 3300025928 Unclassified 2424
33 Ga0207702_10038961 3300026078 Bacteria 3981
34 Ga0207428_10253326 3300027907 Bacteria 1312
35 Ga0265337_1014369 3300028556 Bacteria 2626
36 Ga0265319_1000016 3300028563 Bacteria 176245
37 Ga0265319_1053385 3300028563 Bacteria 1328
38 Ga0265319_1061587 3300028563 Archaea 1216
39 Ga0265318_10089955 3300028577 Unclassified 1131
40 Ga0265338_10001001 3300028800 Bacteria 47438
41 Ga0265338_10001138 3300028800 Bacteria 44040
42 Ga0265338_10001869 3300028800 Bacteria 33054
43 Ga0265338_10002500 3300028800 Bacteria 27381
44 Ga0265338_10023185 3300028800 Bacteria 6391
45 Ga0265338_10036155 3300028800 Bacteria 4733
46 Ga0265338_10049049 3300028800 Bacteria 3832
47 Ga0265338_10052997 3300028800 Bacteria 3634
48 Ga0265338_10056121 3300028800 Bacteria 3497
49 Ga0265338_10057771 3300028800 Unclassified 3430
50 Ga0265338_10425996 3300028800 Bacteria 942
51 Ga0265324_10001684 3300029957 Bacteria 12186
52 Ga0265324_10002866 3300029957 Bacteria 8483
53 Ga0265324_10008271 3300029957 Bacteria 4145
54 Ga0265324_10030679 3300029957 Bacteria 1885
55 Ga0265332_10021653 3300031238 Bacteria 2839
56 Ga0265320_10000362 3300031240 Bacteria 36921
57 Ga0265325_10057714 3300031241 Bacteria 1979
58 Ga0265339_10098708 3300031249 Unclassified 1523
59 Ga0265339_10137416 3300031249 Unclassified 1246
60 Ga0265327_10000848 3300031251 Bacteria 45667
61 Ga0265316_10031628 3300031344 Bacteria 4325
62 Ga0265316_10240008 3300031344 Bacteria 1333
63 Ga0265313_10001733 3300031595 Bacteria 20064
64 Ga0265313_10003486 3300031595 Bacteria 12691
65 Ga0265314_10010552 3300031711 Bacteria 7693
66 Ga0265314_10237917 3300031711 Bacteria 1052
67 Ga0265342_10194849 3300031712 Unclassified 1104
68 Ga0265342_10273964 3300031712 Bacteria 895
69 Ga0373944_0024865 3300035089 Bacteria 1759
70 Ga0373927_0002778 3300035695 Bacteria 12776
71 Ga0373927_0238527 3300035695 Unclassified 1195
72 Ga0316582_0113965 3300036647 Bacteria 1803
73 Ga0373925_0009631 3300037068 Bacteria 7039
74 Ga0373925_0345199 3300037068 Bacteria 1208
75 Ga0453684_0003423 3300044712 Bacteria 35791
76 Ga0453684_0013936 3300044712 Bacteria 12963
77 Ga0453684_0270044 3300044712 Bacteria 1944
78 Ga0453684_0337604 3300044712 Bacteria 1702
79 Ga0495641_0012603 3300046461 Bacteria 4715
80 Ga0495653_0297707 3300046463 Bacteria 1053
81 Ga0495582_0013283 3300046473 Bacteria 4534
82 Ga0495639_0073808 3300046475 Bacteria 1580
83 Ga0495628_0167031 3300046516 Bacteria 1670
84 Ga0495630_0000369 3300046517 Bacteria 35602
85 Ga0495630_0041366 3300046517 Bacteria 3441
86 Ga0495630_0200603 3300046517 Bacteria 1522
87 Ga0495666_0010300 3300046526 Bacteria 4662
88 Ga0495666_0014869 3300046526 Bacteria 3873
89 Ga0495640_0032310 3300046533 Bacteria 3729
90 Ga0495586_0000005 3300046535 Bacteria 171839
91 Ga0495634_0001227 3300046642 Bacteria 23610
92 Ga0495634_0047177 3300046642 Bacteria 2904
93 Ga0495634_0093157 3300046642 Bacteria 1954
94 Ga0495634_0208132 3300046642 Bacteria 1212
95 Ga0495635_0123109 3300046663 Unclassified 1769
96 Ga0495647_0048139 3300046681 Bacteria 1648
97 Ga0495658_0007851 3300046683 Bacteria 5284
98 Ga0495658_0044683 3300046683 Bacteria 2483
99 Ga0495613_0006135 3300046689 Bacteria 8995
100 Ga0495613_0022352 3300046689 Bacteria 4713
101 Ga0495613_0079214 3300046689 Bacteria 2389
102 Ga0495624_0163500 3300046690 Bacteria 1359
103 Ga0495581_0035410 3300047315 Bacteria 2889
104 Ga0495674_0001245 3300047319 Bacteria 24704
105 Ga0495676_0029441 3300047321 Bacteria 4675
106 Ga0495676_0039820 3300047321 Bacteria 3888
107 Ga0495680_0040138 3300047322 Unclassified 3730
108 Ga0495680_0301058 3300047322 Unclassified 1126
109 Ga0495675_0030277 3300047444 Bacteria 3454
110 Ga0501033_0093482 3300049570 Bacteria 2199
111 Ga0501035_0420551 3300049822 Bacteria 1109
112 nmdc:mga00v17_319867_c1 3300050491 Bacteria 1008
113 nmdc:mga05p37_723328_c1 3300050507 Bacteria 1102
114 nmdc:mga0qj67_52890_c1 3300050509 Bacteria 3214
115 nmdc:mga06r32_277091_c1 3300050510 Bacteria 1664
116 nmdc:mga08y16_18245_c1 3300050511 Bacteria 7393
117 nmdc:mga0rr50_269176_c1 3300050513 Bacteria 1419
118 nmdc:mga08x19_171451_c1 3300050514 Bacteria 1478
119 Ga0495601_0075938 3300053077 Bacteria 2151
120 Ga0495618_0268276
121 rootH2_10294440
122 Ga0070676_10178872
123 Ga0070690_100217894
124 Ga0070690_100283780
125 Ga0070713_100130183
126 Ga0070701_10008436
127 Ga0070705_100076336
128 Ga0070694_100002991
129 Ga0068867_100345940
130 Ga0070704_100026905
131 Ga0068856_100000751
132 Ga0068856_100054105
133 Ga0068858_100067378
134 Ga0075428_100001336
135 Ga0075436_100140315
136 Ga0075435_100093624
137 Ga0105240_10048949
138 Ga0111539_10024401
139 Ga0114129_10756315
140 Ga0114129_11015849
141 Ga0105248_10811205
142 Ga0105238_10001107
143 Ga0105238_10490044
144 Ga0157378_10505542
145 Ga0157375_10000006
146 Ga0163163_10000083
147 Ga0157380_10721043
148 Ga0207680_10549090
149 Ga0207694_10002636
150 Ga0207694_10335413
151 Ga0207700_10089740
152 Ga0207702_10038961
153 Ga0207428_10253326
154 Ga0265337_1014369
155 Ga0265319_1000016
156 Ga0265319_1053385
157 Ga0265319_1061587
158 Ga0265318_10089955
159 Ga0265338_10001001
160 Ga0265338_10001138
161 Ga0265338_10001869
162 Ga0265338_10002500
163 Ga0265338_10023185
164 Ga0265338_10036155
165 Ga0265338_10049049
166 Ga0265338_10052997
167 Ga0265338_10056121
168 Ga0265338_10057771
169 Ga0265338_10425996
170 Ga0265324_10001684
171 Ga0265324_10002866
172 Ga0265324_10008271
173 Ga0265324_10030679
174 Ga0265332_10021653
175 Ga0265320_10000362
176 Ga0265325_10057714
177 Ga0265339_10098708
178 Ga0265339_10137416
179 Ga0265327_10000848
180 Ga0265316_10031628
181 Ga0265316_10240008
182 Ga0265313_10001733
183 Ga0265313_10003486
184 Ga0265314_10010552
185 Ga0265314_10237917
186 Ga0265342_10194849
187 Ga0265342_10273964
188 Ga0373944_0024865
189 Ga0373927_0002778
190 Ga0373927_0238527
191 Ga0316582_0113965
192 Ga0373925_0009631
193 Ga0373925_0345199
194 Ga0453684_0003423
195 Ga0453684_0013936
196 Ga0453684_0270044
197 Ga0453684_0337604
198 Ga0495641_0012603
199 Ga0495653_0297707
200 Ga0495582_0013283
201 Ga0495639_0073808
202 Ga0495628_0167031
203 Ga0495630_0000369
204 Ga0495630_0041366
205 Ga0495630_0200603
206 Ga0495666_0010300
207 Ga0495666_0014869
208 Ga0495640_0032310
209 Ga0495586_0000005
210 Ga0495634_0001227
211 Ga0495634_0047177
212 Ga0495634_0093157
213 Ga0495634_0208132
214 Ga0495635_0123109
215 Ga0495647_0048139
216 Ga0495658_0007851
217 Ga0495658_0044683
218 Ga0495613_0006135
219 Ga0495613_0022352
220 Ga0495613_0079214
221 Ga0495624_0163500
222 Ga0495581_0035410
223 Ga0495674_0001245
224 Ga0495676_0029441
225 Ga0495676_0039820
226 Ga0495680_0040138
227 Ga0495680_0301058
228 Ga0495675_0030277
229 Ga0501033_0093482
230 Ga0501035_0420551
231 nmdc:mga00v17_319867_c1
232 nmdc:mga05p37_723328_c1
233 nmdc:mga0qj67_52890_c1
234 nmdc:mga06r32_277091_c1
235 nmdc:mga08y16_18245_c1
236 nmdc:mga0rr50_269176_c1
237 nmdc:mga08x19_171451_c1
238 Ga0495601_0075938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

31

229

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

37

257

0.84

PF08659

KR

KR domain

31

217

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rku-assembly1.cif.gz_D substrate fingerprint and the structure of nadp+ dependent serine dehydrogenase from saccharomyces cerevisiae complexed with nadp+ 0.94 2 242
2nwq-assembly1.cif.gz_A short chain dehydrogenase from pseudomonas aeruginosa 0.94 2 236
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9272 1 234
3asv-assembly1.cif.gz_A the closed form of serine dehydrogenase complexed with nadp+ 0.9254 2 236
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9254 1 232
ID Description Score Start End Superfamily
af_P9WGR5_6_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9529 2 243 3.40.50.720
af_Q9P7B4_1_257_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9448 2 243 3.40.50.720
3rkuD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.94 2 242 3.40.50.720
af_O15744_2_259_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9392 2 243 3.40.50.720
af_F1QDB3_1_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9289 1 233 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2D9N0F3-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9664 2 243 GO:0016491
AF-A0A2D5WGH8-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9633 2 245 GO:0016491
AF-A0A2A4LX60-F1-model_v4 SDR family oxidoreductase 0.9613 50 245 GO:0016491
AF-A0A7U7H0G0-F1-model_v4 deleted 0.961 2 243
AF-H0E4B0-F1-model_v4 Short chain dehydrogenase 0.9606 2 244 GO:0016491

Map