F100473

General Info

Members Datasets Scaffolds Average Seq Length
119 93 119 252

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100130769|Ga0070688_1001307692
Length 260
Sequence MVGGGMDKDNETILEVKNLRKRYGDKEVVKGISFEVKRGEVFGILGPNGAGKTTTFEMIEAMRSIDGGEITVDGIDVQKDPWAVRRIIGVQPQSPSFQDKQKLSEIIEMFAATYGERVNVQEFLDDVNLGEKINDFAENLSGGQRQRLSIAAALVHNPRVFFLDEPTTGLDPQARRNLWKLIEHIRDKGVTVMLTTHYMDEAEILCDRVAIMDRGQIIQLDTPKNLIKQLLAKGFKKEQKVEQANLEDVFIDLTGKALRD

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
78 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
80 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
81 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
82 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
83 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
84 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
85 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
86 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
87 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
88 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
89 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
90 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
91 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
92 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
93 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.49
Nodule 0
Rhizoplane 0.84
Rhizosphere 78.99
Stem 0
Stem Tuber 0
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10000174 3300002244 Bacteria 9518
2 rootH2_10000311 3300003320 Bacteria 277677
3 rootH2_10097681 3300003320 Bacteria 2766
4 Ga0070658_10000051 3300005327 Bacteria 118657
5 Ga0070658_10000339 3300005327 Bacteria 40406
6 Ga0070676_10000888 3300005328 Bacteria 14766
7 Ga0070683_100891215 3300005329 Bacteria 853
8 Ga0070690_100000608 3300005330 Bacteria 18106
9 Ga0070682_100000500 3300005337 Bacteria 24620
10 Ga0070660_100000054 3300005339 Bacteria 67207
11 Ga0070668_100097342 3300005347 Bacteria 2327
12 Ga0070674_100006252 3300005356 Bacteria 6932
13 Ga0070688_100130769 3300005365 Bacteria 1693
14 Ga0070667_100004243 3300005367 Bacteria 12104
15 Ga0070667_100116671 3300005367 Bacteria 2319
16 Ga0070678_100044006 3300005456 Bacteria 3185
17 Ga0070681_10044073 3300005458 Bacteria 4465
18 Ga0070685_10000637 3300005466 Bacteria 19172
19 Ga0070679_100035879 3300005530 Bacteria 4920
20 Ga0070679_100144726 3300005530 Bacteria 2355
21 Ga0070696_100036133 3300005546 Bacteria 3405
22 Ga0070665_100168580 3300005548 Bacteria 2191
23 Ga0068855_100000001 3300005563 Bacteria 818777
24 Ga0068855_100005226 3300005563 Bacteria 15838
25 Ga0070664_100091051 3300005564 Bacteria 2640
26 Ga0068863_100693080 3300005841 Bacteria 1012
27 Ga0068858_100139788 3300005842 Bacteria 2273
28 Ga0068860_100086677 3300005843 Bacteria 2980
29 Ga0068860_100233212 3300005843 Bacteria 1789
30 Ga0068862_100334211 3300005844 Bacteria 1402
31 Ga0081455_10000008 3300005937 Bacteria 256558
32 Ga0075365_10000016 3300006038 Bacteria 71640
33 Ga0075365_10065848 3300006038 Bacteria 2429
34 Ga0075364_10113880 3300006051 Bacteria 1807
35 Ga0075369_10000006 3300006186 Bacteria 132271
36 Ga0075366_10000158 3300006195 Bacteria 28657
37 Ga0097621_100000001 3300006237 Bacteria 632268
38 Ga0068871_100001673 3300006358 Bacteria 14907
39 Ga0105240_10000048 3300009093 Bacteria 237451
40 Ga0105245_10048317 3300009098 Bacteria 3806
41 Ga0105247_10197927 3300009101 Bacteria 1348
42 Ga0105241_10000009 3300009174 Bacteria 258876
43 Ga0105241_10000372 3300009174 Bacteria 34165
44 Ga0105248_10064413 3300009177 Bacteria 4115
45 Ga0105237_10467899 3300009545 Bacteria 1267
46 Ga0105249_10006007 3300009553 Bacteria 10521
47 Ga0105249_11022812 3300009553 Bacteria 895
48 Ga0157371_10069043 3300013102 Bacteria 2502
49 Ga0157369_10000054 3300013105 Bacteria 162631
50 Ga0157369_10273519 3300013105 Bacteria 1760
51 Ga0157378_10334008 3300013297 Bacteria 1476
52 Ga0157372_10000143 3300013307 Bacteria 78295
53 Ga0157372_10089141 3300013307 Bacteria 3504
54 Ga0163163_10012972 3300014325 Bacteria 7612
55 Ga0163163_10084428 3300014325 Bacteria 3181
56 Ga0157377_10025074 3300014745 Unclassified 3178
57 Ga0207645_10028194 3300025907 Bacteria 3626
58 Ga0207705_10000019 3300025909 Bacteria 317770
59 Ga0207705_10000057 3300025909 Bacteria 157369
60 Ga0207654_10000002 3300025911 Bacteria 1460142
61 Ga0207654_10001347 3300025911 Bacteria 13029
62 Ga0207695_10006638 3300025913 Bacteria 14938
63 Ga0207657_10003406 3300025919 Bacteria 16987
64 Ga0207652_10079550 3300025921 Bacteria 2864
65 Ga0207669_10003223 3300025937 Bacteria 7052
66 Ga0207667_10000003 3300025949 Bacteria 822935
67 Ga0207667_10017600 3300025949 Bacteria 8037
68 Ga0207712_10018911 3300025961 Bacteria 4494
69 Ga0207712_10610398 3300025961 Bacteria 944
70 Ga0207668_10071308 3300025972 Bacteria 2481
71 Ga0207658_10008443 3300025986 Bacteria 7010
72 Ga0207658_10018716 3300025986 Bacteria 4787
73 Ga0207703_10303015 3300026035 Bacteria 1458
74 Ga0207641_10770621 3300026088 Bacteria 950
75 Ga0207674_10011293 3300026116 Bacteria 10038
76 Ga0207683_10055868 3300026121 Bacteria 3462
77 Ga0268266_10000942 3300028379 Bacteria 37115
78 Ga0268265_10286292 3300028380 Bacteria 1477
79 Ga0268264_10206155 3300028381 Bacteria 1802
80 Ga0265319_1027655 3300028563 Bacteria 2008
81 Ga0265327_10000025 3300031251 Bacteria 380054
82 Ga0265327_10001779 3300031251 Bacteria 25400
83 Ga0265327_10087658 3300031251 Bacteria 1524
84 Ga0395900_0002550 3300037418 Bacteria 19962
85 Ga0395900_0076134 3300037418 Bacteria 3449
86 Ga0395900_0082156 3300037418 Unclassified 3310
87 Ga0395898_0018801 3300037466 Bacteria 7040
88 Ga0395905_0129455 3300037471 Bacteria 2374
89 Ga0395901_0001706 3300038443 Bacteria 22691
90 Ga0451793_0554050 3300041452 Bacteria 1439
91 Ga0466963_0050523 3300044694 Bacteria 2752
92 Ga0501033_0020240 3300049570 Bacteria 5030
93 Ga0501034_0000024 3300049571 Bacteria 263735
94 Ga0501034_0002390 3300049571 Bacteria 22779
95 Ga0501034_0357869 3300049571 Bacteria 1387
96 Ga0501036_0086640 3300049572 Bacteria 2647
97 Ga0501037_0022572 3300049573 Bacteria 4654
98 Ga0501047_0000024 3300049581 Bacteria 230397
99 Ga0501048_0078468 3300049582 Bacteria 2330
100 Ga0501083_0024971 3300049744 Bacteria 4139
101 Ga0501035_0000005 3300049822 Bacteria 392980
102 Ga0501044_0001150 3300049823 Bacteria 31351
103 nmdc:mga00v17_20322_c1 3300050491 Bacteria 3802
104 nmdc:mga0yw44_66878_c1 3300050492 Bacteria 2219
105 nmdc:mga0yw44_7_c1 3300050492 Bacteria 260877
106 nmdc:mga0k408_47_c1 3300050493 Bacteria 61154
107 nmdc:mga07m45_1481_c1 3300050496 Bacteria 10786
108 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
109 Ga0500644_0009699 3300053088 Bacteria 2584
110 Ga0500583_0000105 3300053092 Bacteria 44085
111 Ga0500555_000001 3300053103 Bacteria 1353713
112 Ga0500556_0000369 3300053104 Bacteria 32993
113 Ga0500556_0062300 3300053104 Bacteria 1376
114 Ga0500562_000002 3300053108 Bacteria 977234
115 Ga0500594_0000070 3300053118 Bacteria 32225
116 Ga0500628_000018 3300053129 Bacteria 85560
117 Ga0500628_011850 3300053129 Bacteria 1593
118 Ga0500642_0144759 3300053130 Bacteria 1115
119 Ga0500589_000003 3300053147 Bacteria 220717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10048317 Ga0105245_100483174 216
2 3300025911 Ga0207654_10001347 Ga0207654_1000134713 216
3 3300013105 Ga0157369_10273519 Ga0157369_102735192 220
4 3300009174 Ga0105241_10000372 Ga0105241_100003726 226
5 3300049744 Ga0501083_0024971 Ga0501083_0024971_265_1026 232
6 3300003320 rootH2_10000311 rootH2_10000311111 248
7 3300002244 JGI24742J22300_10000174 JGI24742J22300_100001749 251
8 3300003320 rootH2_10097681 rootH2_100976814 251
9 3300005327 Ga0070658_10000051 Ga0070658_1000005173 251
10 3300005327 Ga0070658_10000339 Ga0070658_1000033927 251
11 3300005328 Ga0070676_10000888 Ga0070676_100008883 251
12 3300005329 Ga0070683_100891215 Ga0070683_1008912151 251
13 3300005330 Ga0070690_100000608 Ga0070690_10000060813 251
14 3300005337 Ga0070682_100000500 Ga0070682_1000005002 251
15 3300005339 Ga0070660_100000054 Ga0070660_10000005439 251
16 3300005347 Ga0070668_100097342 Ga0070668_1000973422 251
17 3300005356 Ga0070674_100006252 Ga0070674_1000062526 251
18 3300005365 Ga0070688_100130769 Ga0070688_1001307692 251
19 3300005367 Ga0070667_100004243 Ga0070667_1000042438 251
20 3300005367 Ga0070667_100116671 Ga0070667_1001166712 251
21 3300005456 Ga0070678_100044006 Ga0070678_1000440063 251
22 3300005458 Ga0070681_10044073 Ga0070681_100440734 251
23 3300005466 Ga0070685_10000637 Ga0070685_1000063719 251
24 3300005530 Ga0070679_100035879 Ga0070679_1000358796 251
25 3300005530 Ga0070679_100144726 Ga0070679_1001447262 251
26 3300005546 Ga0070696_100036133 Ga0070696_1000361333 251
27 3300005548 Ga0070665_100168580 Ga0070665_1001685802 251
28 3300005563 Ga0068855_100000001 Ga0068855_100000001633 251
29 3300005563 Ga0068855_100005226 Ga0068855_1000052267 251
30 3300005564 Ga0070664_100091051 Ga0070664_1000910512 251
31 3300005841 Ga0068863_100693080 Ga0068863_1006930802 251
32 3300005842 Ga0068858_100139788 Ga0068858_1001397883 251
33 3300005843 Ga0068860_100086677 Ga0068860_1000866773 251
34 3300005843 Ga0068860_100233212 Ga0068860_1002332122 251
35 3300005844 Ga0068862_100334211 Ga0068862_1003342112 251
36 3300005937 Ga0081455_10000008 Ga0081455_10000008285 251
37 3300006038 Ga0075365_10000016 Ga0075365_100000164 251
38 3300006038 Ga0075365_10065848 Ga0075365_100658482 251
39 3300006051 Ga0075364_10113880 Ga0075364_101138802 251
40 3300006186 Ga0075369_10000006 Ga0075369_1000000631 251
41 3300006195 Ga0075366_10000158 Ga0075366_1000015824 251
42 3300006237 Ga0097621_100000001 Ga0097621_100000001392 251
43 3300006358 Ga0068871_100001673 Ga0068871_10000167314 251
44 3300009093 Ga0105240_10000048 Ga0105240_10000048109 251
45 3300009101 Ga0105247_10197927 Ga0105247_101979272 251
46 3300009174 Ga0105241_10000009 Ga0105241_1000000922 251
47 3300009177 Ga0105248_10064413 Ga0105248_100644132 251
48 3300009545 Ga0105237_10467899 Ga0105237_104678992 251
49 3300009553 Ga0105249_10006007 Ga0105249_100060076 251
50 3300009553 Ga0105249_11022812 Ga0105249_110228121 251
51 3300013102 Ga0157371_10069043 Ga0157371_100690432 251
52 3300013105 Ga0157369_10000054 Ga0157369_10000054159 251
53 3300013297 Ga0157378_10334008 Ga0157378_103340082 251
54 3300013307 Ga0157372_10000143 Ga0157372_1000014381 251
55 3300013307 Ga0157372_10089141 Ga0157372_100891412 251
56 3300014325 Ga0163163_10012972 Ga0163163_100129725 251
57 3300014325 Ga0163163_10084428 Ga0163163_100844283 251
58 3300014745 Ga0157377_10025074 Ga0157377_100250747 251
59 3300025907 Ga0207645_10028194 Ga0207645_100281945 251
60 3300025909 Ga0207705_10000019 Ga0207705_10000019111 251
61 3300025909 Ga0207705_10000057 Ga0207705_10000057156 251
62 3300025911 Ga0207654_10000002 Ga0207654_10000002254 251
63 3300025913 Ga0207695_10006638 Ga0207695_100066385 251
64 3300025919 Ga0207657_10003406 Ga0207657_1000340610 251
65 3300025921 Ga0207652_10079550 Ga0207652_100795502 251
66 3300025937 Ga0207669_10003223 Ga0207669_100032234 251
67 3300025949 Ga0207667_10000003 Ga0207667_10000003621 251
68 3300025949 Ga0207667_10017600 Ga0207667_100176005 251
69 3300025961 Ga0207712_10018911 Ga0207712_100189112 251
70 3300025961 Ga0207712_10610398 Ga0207712_106103981 251
71 3300025972 Ga0207668_10071308 Ga0207668_100713082 251
72 3300025986 Ga0207658_10008443 Ga0207658_1000844310 251
73 3300025986 Ga0207658_10018716 Ga0207658_100187164 251
74 3300026035 Ga0207703_10303015 Ga0207703_103030152 251
75 3300026088 Ga0207641_10770621 Ga0207641_107706212 251
76 3300026116 Ga0207674_10011293 Ga0207674_1001129310 251
77 3300026121 Ga0207683_10055868 Ga0207683_100558683 251
78 3300028379 Ga0268266_10000942 Ga0268266_1000094227 251
79 3300028380 Ga0268265_10286292 Ga0268265_102862922 251
80 3300028381 Ga0268264_10206155 Ga0268264_102061552 251
81 3300028563 Ga0265319_1027655 Ga0265319_10276552 251
82 3300031251 Ga0265327_10000025 Ga0265327_10000025179 251
83 3300031251 Ga0265327_10001779 Ga0265327_1000177910 251
84 3300031251 Ga0265327_10087658 Ga0265327_100876582 251
85 3300037418 Ga0395900_0002550 Ga0395900_0002550_17346_18104 251
86 3300037418 Ga0395900_0076134 Ga0395900_0076134_340_1095 251
87 3300037418 Ga0395900_0082156 Ga0395900_0082156_309_1064 251
88 3300037466 Ga0395898_0018801 Ga0395898_0018801_232_987 251
89 3300037471 Ga0395905_0129455 Ga0395905_0129455_564_1319 251
90 3300038443 Ga0395901_0001706 Ga0395901_0001706_20750_21505 251
91 3300041452 Ga0451793_0554050 Ga0451793_0554050_649_1407 251
92 3300044694 Ga0466963_0050523 Ga0466963_0050523_649_1413 251
93 3300049570 Ga0501033_0020240 Ga0501033_0020240_606_1367 251
94 3300049571 Ga0501034_0000024 Ga0501034_0000024_128406_129173 251
95 3300049571 Ga0501034_0002390 Ga0501034_0002390_11478_12239 251
96 3300049571 Ga0501034_0357869 Ga0501034_0357869_89_847 251
97 3300049572 Ga0501036_0086640 Ga0501036_0086640_937_1698 251
98 3300049573 Ga0501037_0022572 Ga0501037_0022572_810_1571 251
99 3300049581 Ga0501047_0000024 Ga0501047_0000024_218452_219213 251
100 3300049582 Ga0501048_0078468 Ga0501048_0078468_1234_1995 251
101 3300049822 Ga0501035_0000005 Ga0501035_0000005_218537_219298 251
102 3300049823 Ga0501044_0001150 Ga0501044_0001150_23129_23890 251
103 3300050491 nmdc:mga00v17_20322_c1 nmdc:mga00v17_20322_c1_1313_2071 251
104 3300050492 nmdc:mga0yw44_66878_c1 nmdc:mga0yw44_66878_c1_579_1337 251
105 3300050492 nmdc:mga0yw44_7_c1 nmdc:mga0yw44_7_c1_38908_39675 251
106 3300050493 nmdc:mga0k408_47_c1 nmdc:mga0k408_47_c1_2439_3197 251
107 3300050496 nmdc:mga07m45_1481_c1 nmdc:mga07m45_1481_c1_9493_10260 251
108 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_300513_301268 251
109 3300053088 Ga0500644_0009699 Ga0500644_0009699_673_1431 251
110 3300053092 Ga0500583_0000105 Ga0500583_0000105_37745_38500 251
111 3300053103 Ga0500555_000001 Ga0500555_000001_221223_221978 251
112 3300053104 Ga0500556_0000369 Ga0500556_0000369_17355_18113 251
113 3300053104 Ga0500556_0062300 Ga0500556_0062300_333_1091 251
114 3300053108 Ga0500562_000002 Ga0500562_000002_466612_467370 251
115 3300053118 Ga0500594_0000070 Ga0500594_0000070_26417_27175 251
116 3300053129 Ga0500628_000018 Ga0500628_000018_71460_72218 251
117 3300053129 Ga0500628_011850 Ga0500628_011850_148_903 251
118 3300053130 Ga0500642_0144759 Ga0500642_0144759_179_961 251
119 3300053147 Ga0500589_000003 Ga0500589_000003_214340_215122 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

29

168

0.95

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

93

199

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9362 2 213
8edw-assembly1.cif.gz_A cryo-em structure of human abca7 in bpl/ch nanodiscs 0.9353 3 222
8eeb-assembly1.cif.gz_A cryo-em structure of human abca7 in digitonin 0.9301 3 218
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9286 1 249
7lkp-assembly1.cif.gz_A structure of atp-free human abca4 0.9224 3 221
ID Description Score Start End Superfamily
af_Q9VVK6_333_568_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9492 2 221 3.40.50.300
af_Q9VVJ9_503_747_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9412 2 207 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9355 4 217 3.40.50.300
af_Q0E8Q7_1247_1483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9331 1 219 3.40.50.300
af_Q54R52_468_723_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9324 3 222 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X0I8X8-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.965 2 221 GO:0005524
GO:0016887
GO:0046677
AF-A0A820X1S1-F1-model_v4 ABC transporter domain-containing protein 0.9632 2 220 GO:0005319
GO:0005524
GO:0016020
GO:0016887
GO:0043231
GO:0140359
AF-L9X2C7-F1-model_v4 ABC transporter-like protein 0.9626 2 221 GO:0005524
GO:0016887
AF-A0A7G9REB6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9619 1 220 GO:0005524
GO:0016887
GO:0043215
GO:0046677
GO:1900753
AF-A0A2S6WL76-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9611 1 219 GO:0005524
GO:0016887
GO:0046677

Feature Viewer

pLDDT pTM Quality
85.05 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map