F099857

General Info

Members Datasets Scaffolds Average Seq Length
119 94 238 142

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10002134|Ga0055531_1000213410
Length 137
Sequence MVENKTKATDASVETYIASRANDQQAADCRELMALFRKLTKQPPKMWGPSIVGYGSYRYTYESGRTGEAPLAGFAIRGRELVVYLDCEDNDNSLLPKLGKHKMGKSCLYFKQLADLDVSILERLVAASIARTQQRYG

Samples

Sample ID Description Type Environment
1 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
32 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
46 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
51 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
52 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
53 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
54 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
55 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
56 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
57 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
58 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
59 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
60 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
61 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
62 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
63 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
69 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
70 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
71 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
72 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
73 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
74 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
75 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
76 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
77 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
78 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
79 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
80 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
81 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
84 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
85 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
86 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
89 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
90 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
91 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
92 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
93 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
94 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.36
Nodule 0
Rhizoplane 5.04
Rhizosphere 88.24
Stem 0
Stem Tuber 0
Unclassified 25.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055531_10002134 3300003794 Bacteria 13541
2 SwRhRL2b_contig_1128492 2162886007 Bacteria 1756
3 Ga0065704_10018915 3300005289 Bacteria 1323
4 Ga0070680_100095869 3300005336 Bacteria 2460
5 Ga0070674_100906565 3300005356 Unclassified 768
6 Ga0070673_100337645 3300005364 Bacteria 1334
7 Ga0070700_100889263 3300005441 Unclassified 724
8 Ga0068867_100678542 3300005459 Unclassified 907
9 Ga0070679_100439429 3300005530 Bacteria 1250
10 Ga0070696_101333234 3300005546 Bacteria 610
11 Ga0070665_100592511 3300005548 Unclassified 1122
12 Ga0070704_101411106 3300005549 Bacteria 639
13 Ga0070664_100032210 3300005564 Bacteria 4384
14 Ga0068859_100872387 3300005617 Unclassified 985
15 Ga0068870_10042413 3300005840 Unclassified 2369
16 Ga0068860_102323164 3300005843 Bacteria 557
17 Ga0075363_100313249 3300006048 Bacteria 912
18 Ga0075428_100418946 3300006844 Bacteria 1435
19 Ga0075428_101753939 3300006844 Unclassified 647
20 Ga0075430_100042633 3300006846 Bacteria 3837
21 Ga0075430_100074236 3300006846 Bacteria 2852
22 Ga0075430_100088438 3300006846 Bacteria 2592
23 Ga0075431_100540144 3300006847 Bacteria 1154
24 Ga0075431_100892884 3300006847 Unclassified 859
25 Ga0075429_100055850 3300006880 Bacteria 3436
26 Ga0075429_100565286 3300006880 Bacteria 997
27 Ga0075429_100617687 3300006880 Unclassified 950
28 Ga0097620_100872444 3300006931 Unclassified 985
29 Ga0111539_10415672 3300009094 Unclassified 1566
30 Ga0111539_11010713 3300009094 Bacteria 967
31 Ga0105245_11552791 3300009098 Bacteria 713
32 Ga0114129_11416026 3300009147 Unclassified 857
33 Ga0114129_11672367 3300009147 Bacteria 777
34 Ga0105241_11906898 3300009174 Bacteria 582
35 Ga0105242_10337085 3300009176 Bacteria 1388
36 Ga0105249_12607042 3300009553 Unclassified 578
37 Ga0157375_11415626 3300013308 Bacteria 819
38 Ga0157380_10556822 3300014326 Unclassified 1126
39 Ga0157380_10587087 3300014326 Bacteria 1100
40 Ga0157380_11527812 3300014326 Bacteria 721
41 Ga0213876_10021255 3300021384 Bacteria 3433
42 Ga0209257_1000526 3300025304 Bacteria 66538
43 Ga0207660_10554796 3300025917 Unclassified 934
44 Ga0207652_10552667 3300025921 Bacteria 1034
45 Ga0207686_10174228 3300025934 Bacteria 1520
46 Ga0207669_11025610 3300025937 Unclassified 694
47 Ga0207651_10817496 3300025960 Bacteria 827
48 Ga0207708_10839593 3300026075 Unclassified 793
49 Ga0207675_101000412 3300026118 Bacteria 854
50 Ga0210002_1092762 3300027617 Bacteria 543
51 Ga0209971_1028198 3300027682 Bacteria 1344
52 Ga0209998_10005300 3300027717 Bacteria 2705
53 Ga0268266_10441618 3300028379 Unclassified 1236
54 Ga0268264_11551116 3300028381 Bacteria 673
55 Ga0316180_1104300 3300030736 Bacteria 2196
56 Ga0265327_10015659 3300031251 Bacteria 4877
57 Ga0307405_11246614 3300031731 Bacteria 645
58 Ga0307416_100471737 3300032002 Bacteria 1313
59 Ga0307416_100934285 3300032002 Unclassified 969
60 Ga0307416_103438445 3300032002 Bacteria 530
61 Ga0307411_10171215 3300032005 Bacteria 1638
62 Ga0373960_0062430 3300035121 Bacteria 1134
63 Ga0373962_0372427 3300035242 Unclassified 520
64 Ga0436365_1185711 3300039437 Bacteria 4743
65 Ga0439439_0105458 3300041406 Bacteria 778
66 Ga0439461_0135583 3300041410 Bacteria 626
67 Ga0451789_0832258 3300041443 Unclassified 551
68 Ga0451791_0964130 3300041451 Bacteria 1166
69 Ga0451791_1257439 3300041451 Bacteria 952
70 Ga0451795_1395172 3300041456 Bacteria 950
71 Ga0451802_0433225 3300041460 Bacteria 1025
72 Ga0451807_2390463 3300041486 Bacteria 1206
73 Ga0451841_1279234 3300041498 Bacteria 1964
74 Ga0451843_1288952 3300041509 Bacteria 3354
75 Ga0439456_115756 3300042013 Bacteria 612
76 Ga0439434_0044591 3300042435 Archaea 1367
77 Ga0451577_0032612 3300042876 Bacteria 4692
78 Ga0451577_0054855 3300042876 Bacteria 3557
79 Ga0453683_0005945 3300044673 Bacteria 8415
80 Ga0453684_0014569 3300044712 Bacteria 12555
81 Ga0453684_0060792 3300044712 Bacteria 4855
82 Ga0451576_0765938 3300045051 Bacteria 1014
83 Ga0451576_1050902 3300045051 Unclassified 853
84 Ga0495617_071129 3300046452 Bacteria 1144
85 Ga0495650_0000815 3300046471 Bacteria 37931
86 Ga0495585_0014990 3300046492 Bacteria 4507
87 Ga0495607_0024408 3300046501 Bacteria 3770
88 Ga0495616_0010542 3300046513 Bacteria 5345
89 Ga0495598_0405187 3300046537 Bacteria 534
90 Ga0495633_0011224 3300046558 Bacteria 4843
91 Ga0495656_0271864 3300046615 Bacteria 861
92 Ga0495625_0000320 3300046660 Bacteria 73013
93 Ga0495661_0045414 3300046665 Bacteria 2687
94 Ga0495670_0000609 3300046691 Bacteria 17099
95 Ga0495636_0001693 3300047318 Bacteria 8397
96 Ga0495672_0178999 3300047320 Bacteria 1075
97 Ga0501032_0487652 3300049569 Bacteria 788
98 Ga0501070_0205579 3300049586 Bacteria 1617
99 Ga0501076_0873105 3300049592 Bacteria 742
100 Ga0501077_0169523 3300049593 Bacteria 1387
101 Ga0501077_0244365 3300049593 Bacteria 1141
102 Ga0501079_1370301 3300049741 Bacteria 557
103 Ga0501081_0170725 3300049743 Bacteria 1570
104 Ga0501044_0903289 3300049823 Unclassified 758
105 nmdc:mga03683_288659_c1 3300050489 Unclassified 767
106 nmdc:mga0qj67_1009863_c1 3300050509 Unclassified 652
107 nmdc:mga0qj67_1271040_c1 3300050509 Bacteria 571
108 nmdc:mga0qj67_13284_c1 3300050509 Bacteria 6214
109 nmdc:mga0qj67_151446_c1 3300050509 Unclassified 1882
110 nmdc:mga0qj67_83133_c1 3300050509 Bacteria 2567
111 nmdc:mga06r32_455810_c2 3300050510 Unclassified 823
112 nmdc:mga06r32_552649_c1 3300050510 Bacteria 1125
113 nmdc:mga06r32_568987_c1 3300050510 Bacteria 1106
114 nmdc:mga08y16_208854_c1 3300050511 Unclassified 2022
115 nmdc:mga08y16_419705_c1 3300050511 Unclassified 1367
116 Ga0501084_0587517 3300054114 Bacteria 941
117 Ga0501084_1249649 3300054114 Unclassified 623
118 Ga0590071_107561 3300059421 Bacteria 706
119 Ga0501082_0234737 3300060353 Bacteria 1596
120 Ga0055531_10002134
121 SwRhRL2b_contig_1128492
122 Ga0065704_10018915
123 Ga0070680_100095869
124 Ga0070674_100906565
125 Ga0070673_100337645
126 Ga0070700_100889263
127 Ga0068867_100678542
128 Ga0070679_100439429
129 Ga0070696_101333234
130 Ga0070665_100592511
131 Ga0070704_101411106
132 Ga0070664_100032210
133 Ga0068859_100872387
134 Ga0068870_10042413
135 Ga0068860_102323164
136 Ga0075363_100313249
137 Ga0075428_100418946
138 Ga0075428_101753939
139 Ga0075430_100042633
140 Ga0075430_100074236
141 Ga0075430_100088438
142 Ga0075431_100540144
143 Ga0075431_100892884
144 Ga0075429_100055850
145 Ga0075429_100565286
146 Ga0075429_100617687
147 Ga0097620_100872444
148 Ga0111539_10415672
149 Ga0111539_11010713
150 Ga0105245_11552791
151 Ga0114129_11416026
152 Ga0114129_11672367
153 Ga0105241_11906898
154 Ga0105242_10337085
155 Ga0105249_12607042
156 Ga0157375_11415626
157 Ga0157380_10556822
158 Ga0157380_10587087
159 Ga0157380_11527812
160 Ga0213876_10021255
161 Ga0209257_1000526
162 Ga0207660_10554796
163 Ga0207652_10552667
164 Ga0207686_10174228
165 Ga0207669_11025610
166 Ga0207651_10817496
167 Ga0207708_10839593
168 Ga0207675_101000412
169 Ga0210002_1092762
170 Ga0209971_1028198
171 Ga0209998_10005300
172 Ga0268266_10441618
173 Ga0268264_11551116
174 Ga0316180_1104300
175 Ga0265327_10015659
176 Ga0307405_11246614
177 Ga0307416_100471737
178 Ga0307416_100934285
179 Ga0307416_103438445
180 Ga0307411_10171215
181 Ga0373960_0062430
182 Ga0373962_0372427
183 Ga0436365_1185711
184 Ga0439439_0105458
185 Ga0439461_0135583
186 Ga0451789_0832258
187 Ga0451791_0964130
188 Ga0451791_1257439
189 Ga0451795_1395172
190 Ga0451802_0433225
191 Ga0451807_2390463
192 Ga0451841_1279234
193 Ga0451843_1288952
194 Ga0439456_115756
195 Ga0439434_0044591
196 Ga0451577_0032612
197 Ga0451577_0054855
198 Ga0453683_0005945
199 Ga0453684_0014569
200 Ga0453684_0060792
201 Ga0451576_0765938
202 Ga0451576_1050902
203 Ga0495617_071129
204 Ga0495650_0000815
205 Ga0495585_0014990
206 Ga0495607_0024408
207 Ga0495616_0010542
208 Ga0495598_0405187
209 Ga0495633_0011224
210 Ga0495656_0271864
211 Ga0495625_0000320
212 Ga0495661_0045414
213 Ga0495670_0000609
214 Ga0495636_0001693
215 Ga0495672_0178999
216 Ga0501032_0487652
217 Ga0501070_0205579
218 Ga0501076_0873105
219 Ga0501077_0169523
220 Ga0501077_0244365
221 Ga0501079_1370301
222 Ga0501081_0170725
223 Ga0501044_0903289
224 nmdc:mga03683_288659_c1
225 nmdc:mga0qj67_1009863_c1
226 nmdc:mga0qj67_1271040_c1
227 nmdc:mga0qj67_13284_c1
228 nmdc:mga0qj67_151446_c1
229 nmdc:mga0qj67_83133_c1
230 nmdc:mga06r32_455810_c2
231 nmdc:mga06r32_552649_c1
232 nmdc:mga06r32_568987_c1
233 nmdc:mga08y16_208854_c1
234 nmdc:mga08y16_419705_c1
235 Ga0501084_0587517
236 Ga0501084_1249649
237 Ga0590071_107561
238 Ga0501082_0234737

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

25

129

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7349 18 136
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.7277 18 140
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6819 18 140
7xxm-assembly2.cif.gz_G orf1-glycine-4-aminobutylthricin complex 0.6695 111 138
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6551 18 136
ID Description Score Start End Superfamily
af_F5GUE5_124_321_2.60.200.10 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.743 76 88 2.60.200.10
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7312 18 136 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6941 18 136 3.90.1150.200
af_Q8IIW6_8_142_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5907 56 74 3.30.420.40
af_A0A486WVT5_76_375_3.30.559.70 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Choline/Carnitine o-acyltransferase, domain 2 0.5787 110 147 3.30.559.70
ID Description Score Start End GO Terms
AF-A0A7V9PKA4-F1-model_v4 DUF1801 domain-containing protein 0.9896 31 141
AF-A0A4Q3UA75-F1-model_v4 DUF1801 domain-containing protein 0.9706 25 138
AF-A0A7V9PKA4-F1-model_v4 DUF1801 domain-containing protein 0.9638 31 141
AF-A0A0J1BL92-F1-model_v4 YdhG-like domain-containing protein 0.9616 14 142
AF-A0A352KLD5-F1-model_v4 DUF1801 domain-containing protein 0.9608 77 141

Map