F097329

General Info

Members Datasets Scaffolds Average Seq Length
118 83 236 394

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10002588|Ga0157369_1000258816
Length 416
Sequence MKYMNQSPDSPTNHTLPPVVTGDQPQPQPYVPQQPPVARRQMPRGLWARIAMIGGIILLALIAGYAGSRLATWGQVNDSDLASRLNGGTDGNTLITPEEENLASVVSKVSPSVVSIVTQSQTRDFYYGSSTEEGAGTGIIVSKDGYIMTNKHVIEGASTVGVILSDGTSYDDVQVLGSDPLNDVAFLRIPDVRDLPVAELGDSTSVRVGQKVVAIGNSLGQYQNTVTSGIISGTGRPVAAQAGEQVETLTDLIQTDAAINPGNSGGPLLNLHGQVIGLNTAIAADAQGIGFSIPIGATKGLLKGVLAGKGVQRSYLGVNYVPITADVAEYYKLSVKKGAYIYNGTDKTAVAANSPAAKAGIKDKDIITKVGDIEVGDRGSVASLVAEYAPGDTIKLTIIRGDKTMTTQVTLTAFKN

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
27 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
28 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
39 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
40 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
41 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
42 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
43 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
44 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
45 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
46 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
47 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
48 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
49 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
50 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
51 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
52 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
53 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
54 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
55 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
56 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
57 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
58 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
60 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
61 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
62 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
63 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
64 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
65 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
66 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
67 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
68 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
69 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
70 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
71 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
72 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
73 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
74 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
75 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
76 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
77 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
78 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
79 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
80 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
81 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
82 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
83 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 44.07
Nodule 0
Rhizoplane 0.85
Rhizosphere 53.39
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10002588 3300013105 Bacteria 21632
2 MBSR1b_contig_11878526 2162886012 Unclassified 2242
3 JGI24740J21852_10002781 3300001979 Bacteria 7830
4 rootH1_10058345 3300003323 Bacteria 42716
5 Ga0070660_100000099 3300005339 Bacteria 52371
6 Ga0070692_10021642 3300005345 Bacteria 3130
7 Ga0068855_100000364 3300005563 Bacteria 56128
8 Ga0068855_100029574 3300005563 Bacteria 6548
9 Ga0070664_100080288 3300005564 Bacteria 2809
10 Ga0068857_100018098 3300005577 Bacteria 6180
11 Ga0068852_100032756 3300005616 Bacteria 4306
12 Ga0081455_10000006 3300005937 Bacteria 323066
13 Ga0075365_10000034 3300006038 Bacteria 51086
14 Ga0075365_10000091 3300006038 Bacteria 26191
15 Ga0075365_10000444 3300006038 Bacteria 15407
16 Ga0075365_10000465 3300006038 Bacteria 15218
17 Ga0075365_10022280 3300006038 Bacteria 3968
18 Ga0075368_10012567 3300006042 Bacteria 3097
19 Ga0075363_100003197 3300006048 Bacteria 6909
20 Ga0075364_10000339 3300006051 Bacteria 23276
21 Ga0075364_10000539 3300006051 Bacteria 19327
22 Ga0075364_10008165 3300006051 Bacteria 6248
23 Ga0075364_10041163 3300006051 Bacteria 2999
24 Ga0075362_10003296 3300006177 Bacteria 5618
25 Ga0075367_10000011 3300006178 Bacteria 43060
26 Ga0075369_10010796 3300006186 Bacteria 3578
27 Ga0075366_10053380 3300006195 Unclassified 2401
28 Ga0097621_100000001 3300006237 Bacteria 632268
29 Ga0075370_10054446 3300006353 Bacteria 2272
30 Ga0068871_100000005 3300006358 Bacteria 123210
31 Ga0105240_10000004 3300009093 Bacteria 708156
32 Ga0105240_10004061 3300009093 Bacteria 22519
33 Ga0105237_10000488 3300009545 Bacteria 56363
34 Ga0105238_10066494 3300009551 Bacteria 3606
35 Ga0105032_100003 3300009979 Bacteria 186985
36 Ga0105029_100147 3300009984 Bacteria 3589
37 Ga0105028_100023 3300009993 Bacteria 18488
38 Ga0105028_100040 3300009993 Bacteria 14786
39 Ga0157371_10061408 3300013102 Bacteria 2665
40 Ga0157370_10000706 3300013104 Bacteria 41789
41 Ga0157370_10117090 3300013104 Bacteria 2489
42 Ga0157369_10000024 3300013105 Bacteria 225851
43 Ga0157369_10001762 3300013105 Bacteria 26232
44 Ga0157369_10113633 3300013105 Bacteria 2876
45 Ga0157372_10000002 3300013307 Bacteria 687862
46 Ga0157372_10204688 3300013307 Bacteria 2287
47 Ga0207695_10000009 3300025913 Bacteria 1034276
48 Ga0207671_10000003 3300025914 Bacteria 1065461
49 Ga0207657_10001608 3300025919 Bacteria 24283
50 Ga0207679_10059996 3300025945 Bacteria 2824
51 Ga0207667_10000434 3300025949 Bacteria 56114
52 Ga0207667_10005766 3300025949 Bacteria 15108
53 Ga0207698_10011761 3300026142 Bacteria 5690
54 Ga0314311_1092627 3300030733 Bacteria 12200
55 Ga0316179_1024327 3300030734 Bacteria 28090
56 Ga0316183_1010007 3300030742 Bacteria 20400
57 Ga0316182_1030052 3300030745 Bacteria 42417
58 Ga0316182_1172812 3300030745 Bacteria 50125
59 Ga0316182_1184900 3300030745 Bacteria 5719
60 Ga0307516_10019877 3300031730 Bacteria 6942
61 Ga0307406_10000001 3300031901 Bacteria 638191
62 Ga0307406_10000916 3300031901 Bacteria 16532
63 Ga0439447_025737 3300041407 Bacteria 1514
64 Ga0439461_0001195 3300041410 Bacteria 3967
65 Ga0439461_0002924 3300041410 Bacteria 2772
66 Ga0439431_0026391 3300041997 Bacteria 1423
67 Ga0439442_002150 3300042002 Bacteria 3873
68 Ga0439445_0000951 3300042004 Bacteria 6169
69 Ga0439432_001021 3300042006 Bacteria 10592
70 Ga0439446_0000005 3300042156 Bacteria 101649
71 Ga0450909_001697 3300042185 Bacteria 3086
72 Ga0439434_0002108 3300042435 Bacteria 5753
73 Ga0439464_0045879 3300042439 Bacteria 1255
74 Ga0466965_0000073 3300044683 Bacteria 29903
75 Ga0495638_0000108 3300046460 Bacteria 132914
76 Ga0495638_0000173 3300046460 Bacteria 100531
77 Ga0495660_0000035 3300046810 Bacteria 199140
78 Ga0495660_0002305 3300046810 Bacteria 12236
79 Ga0496115_0000405 3300048918 Bacteria 35545
80 Ga0501034_0000942 3300049571 Bacteria 42231
81 Ga0501034_0002158 3300049571 Bacteria 24404
82 Ga0501037_0000001 3300049573 Bacteria 753276
83 nmdc:mga03683_1001_c2 3300050489 Bacteria 5648
84 nmdc:mga00v17_224_c1 3300050491 Bacteria 33722
85 nmdc:mga00v17_22909_c1 3300050491 Bacteria 3610
86 nmdc:mga00v17_2522_c2 3300050491 Bacteria 3977
87 nmdc:mga00v17_5644_c1 3300050491 Bacteria 6600
88 nmdc:mga0yw44_122_c1 3300050492 Bacteria 27269
89 nmdc:mga0yw44_1346_c1 3300050492 Bacteria 9731
90 nmdc:mga0yw44_31_c1 3300050492 Bacteria 51752
91 nmdc:mga0yw44_6_c1 3300050492 Bacteria 272478
92 nmdc:mga0yw44_91830_c1 3300050492 Bacteria 1920
93 nmdc:mga0yw44_98_c1 3300050492 Bacteria 30535
94 nmdc:mga0k408_5959_c1 3300050493 Bacteria 4790
95 nmdc:mga06z11_1737_c1 3300050494 Bacteria 8196
96 nmdc:mga04h51_122_c1 3300050495 Bacteria 22932
97 nmdc:mga07m45_20543_c2 3300050496 Bacteria 1402
98 nmdc:mga0sz30_2169_c1 3300050516 Bacteria 7016
99 Ga0500643_011777 3300053087 Bacteria 3168
100 Ga0500646_0000001 3300053090 Bacteria 273936
101 Ga0500583_0001004 3300053092 Bacteria 8013
102 Ga0500583_0109582 3300053092 Bacteria 1359
103 Ga0500651_0000019 3300053093 Bacteria 141974
104 Ga0500651_0000580 3300053093 Bacteria 18445
105 Ga0500641_0000001 3300053096 Bacteria 1115973
106 Ga0500555_000005 3300053103 Bacteria 342334
107 Ga0500562_000001 3300053108 Bacteria 1178987
108 Ga0500569_000004 3300053109 Bacteria 100531
109 Ga0500594_0000111 3300053118 Bacteria 23911
110 Ga0500652_000001 3300053131 Bacteria 946868
111 Ga0500655_001960 3300053133 Bacteria 3823
112 Ga0500577_0000494 3300053142 Bacteria 10144
113 Ga0500577_0004163 3300053142 Bacteria 3802
114 Ga0500588_0000082 3300053146 Bacteria 12473
115 Ga0500616_0000067 3300053153 Bacteria 236311
116 Ga0500616_0015103 3300053153 Bacteria 4424
117 Ga0500570_000235 3300053724 Bacteria 18376
118 Ga0500613_000588 3300053738 Bacteria 2061
119 Ga0157369_10002588
120 MBSR1b_contig_11878526
121 JGI24740J21852_10002781
122 rootH1_10058345
123 Ga0070660_100000099
124 Ga0070692_10021642
125 Ga0068855_100000364
126 Ga0068855_100029574
127 Ga0070664_100080288
128 Ga0068857_100018098
129 Ga0068852_100032756
130 Ga0081455_10000006
131 Ga0075365_10000034
132 Ga0075365_10000091
133 Ga0075365_10000444
134 Ga0075365_10000465
135 Ga0075365_10022280
136 Ga0075368_10012567
137 Ga0075363_100003197
138 Ga0075364_10000339
139 Ga0075364_10000539
140 Ga0075364_10008165
141 Ga0075364_10041163
142 Ga0075362_10003296
143 Ga0075367_10000011
144 Ga0075369_10010796
145 Ga0075366_10053380
146 Ga0097621_100000001
147 Ga0075370_10054446
148 Ga0068871_100000005
149 Ga0105240_10000004
150 Ga0105240_10004061
151 Ga0105237_10000488
152 Ga0105238_10066494
153 Ga0105032_100003
154 Ga0105029_100147
155 Ga0105028_100023
156 Ga0105028_100040
157 Ga0157371_10061408
158 Ga0157370_10000706
159 Ga0157370_10117090
160 Ga0157369_10000024
161 Ga0157369_10001762
162 Ga0157369_10113633
163 Ga0157372_10000002
164 Ga0157372_10204688
165 Ga0207695_10000009
166 Ga0207671_10000003
167 Ga0207657_10001608
168 Ga0207679_10059996
169 Ga0207667_10000434
170 Ga0207667_10005766
171 Ga0207698_10011761
172 Ga0314311_1092627
173 Ga0316179_1024327
174 Ga0316183_1010007
175 Ga0316182_1030052
176 Ga0316182_1172812
177 Ga0316182_1184900
178 Ga0307516_10019877
179 Ga0307406_10000001
180 Ga0307406_10000916
181 Ga0439447_025737
182 Ga0439461_0001195
183 Ga0439461_0002924
184 Ga0439431_0026391
185 Ga0439442_002150
186 Ga0439445_0000951
187 Ga0439432_001021
188 Ga0439446_0000005
189 Ga0450909_001697
190 Ga0439434_0002108
191 Ga0439464_0045879
192 Ga0466965_0000073
193 Ga0495638_0000108
194 Ga0495638_0000173
195 Ga0495660_0000035
196 Ga0495660_0002305
197 Ga0496115_0000405
198 Ga0501034_0000942
199 Ga0501034_0002158
200 Ga0501037_0000001
201 nmdc:mga03683_1001_c2
202 nmdc:mga00v17_224_c1
203 nmdc:mga00v17_22909_c1
204 nmdc:mga00v17_2522_c2
205 nmdc:mga00v17_5644_c1
206 nmdc:mga0yw44_122_c1
207 nmdc:mga0yw44_1346_c1
208 nmdc:mga0yw44_31_c1
209 nmdc:mga0yw44_6_c1
210 nmdc:mga0yw44_91830_c1
211 nmdc:mga0yw44_98_c1
212 nmdc:mga0k408_5959_c1
213 nmdc:mga06z11_1737_c1
214 nmdc:mga04h51_122_c1
215 nmdc:mga07m45_20543_c2
216 nmdc:mga0sz30_2169_c1
217 Ga0500643_011777
218 Ga0500646_0000001
219 Ga0500583_0001004
220 Ga0500583_0109582
221 Ga0500651_0000019
222 Ga0500651_0000580
223 Ga0500641_0000001
224 Ga0500555_000005
225 Ga0500562_000001
226 Ga0500569_000004
227 Ga0500594_0000111
228 Ga0500652_000001
229 Ga0500655_001960
230 Ga0500577_0000494
231 Ga0500577_0004163
232 Ga0500588_0000082
233 Ga0500616_0000067
234 Ga0500616_0015103
235 Ga0500570_000235
236 Ga0500613_000588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13365

Trypsin_2

Trypsin-like peptidase domain

136

278

0.95

PF17820

PDZ_6

PDZ domain

348

400

0.95

PF13180

PDZ_2

PDZ domain

314

411

0.89

PF00089

Trypsin

Trypsin

115

300

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sti-assembly1.cif.gz_B crystal structure of the protease domain of degq from escherichia coli 0.8996 71 277
3nwu-assembly1.cif.gz_C substrate induced remodeling of the active site regulates htra1 activity 0.8949 63 264
3nwu-assembly1.cif.gz_B substrate induced remodeling of the active site regulates htra1 activity 0.8936 65 262
6z0x-assembly2.cif.gz_B htra1 inactive protease domain s328a with carasil mutations d174r r274q 0.8908 70 262
6z0x-assembly1.cif.gz_A-4 htra1 inactive protease domain s328a with carasil mutations d174r r274q 0.8878 63 278
ID Description Score Start End Superfamily
3mh4B01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.926 80 167 2.40.10.10
3stjA01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9204 72 157 2.40.10.10
af_O07175_48_145_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9089 72 169 2.40.10.10
3pv4A01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9041 72 159 2.40.10.10
5t69A01 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9035 70 276 2.40.10.120
ID Description Score Start End GO Terms
AF-A0A4V1TUZ0-F1-model_v4 deleted 0.9594 199 384
AF-A0A4V1TUZ0-F1-model_v4 deleted 0.9543 199 384
AF-A0A7T9D1B9-F1-model_v4 deleted 0.9309 276 383
AF-N1Z1T9-F1-model_v4 Copper amine oxidase-like N-terminal domain-containing protein 0.93 71 265 GO:0004252
GO:0006508
AF-A0A0G1N1M7-F1-model_v4 2-alkenal reductase 0.9235 287 384

Map