F089945

General Info

Members Datasets Scaffolds Average Seq Length
116 89 85 450

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0002003|Ga0496117_0002003_21861_23438
Length 525
Sequence MRIVAASSHTTGKSYTSTRYPILNETGEIPRIRRISGSMTTQAGGKAACPVSTQIHLARFLQHDGKGAAMVTRRSFLSGLALGAAGAATDARAQTQRVPVLDVDLRGSIDAAAHGIRPGAGDRKSKAFAKLLKDAAAKNMPVFLPPGDYVISNLTLPDNTRLTGVPGATRIVYGGDGHLFAADGAARIELANLVIDGANRWLDDTVQGLLHVSAVANLTIENCEIQGSAKSAIYMERSGGRIERSRISGAADHAIHAVESQTLSVTGNQVFDCGNGGILIHRWQAGRDGSIVSGNRIARISATRGGTGQYGNGINIFRADDVMITNNHVSGCAFSAIRANAGSNVQISGNTCLDSGETAIYSEFGFTGAVVNGNLVDGAANGILIVNFNEGGRLATVTGNVVRNLKLDGPYIHEGAGFXXXIAVEADTVLSGNTVENAPKWGLVLGWGPYMRGLVVNGNLVRNSPVGCAVSVVEGAGSALISGNIFEETRTAAIAGFRWNERTTDDLATASESYPHLTIERNRTG

Samples

Sample ID Description Type Environment
1 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
2 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
3 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
4 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
5 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
6 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
7 2643221558 Rhizobium sp. Root149 Isolate Unclassified
8 2643221607 Rhizobium sp. Root73 Isolate Unclassified
9 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
10 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
11 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
12 2643221688 Rhizobium sp. Root482 Isolate Unclassified
13 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
14 2643221718 Rhizobium sp. Root268 Isolate Unclassified
15 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
16 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
17 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
18 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
19 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
20 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
21 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
22 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
23 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
24 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
25 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
26 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
27 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
28 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
29 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
30 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
38 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
39 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
40 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
41 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
50 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
58 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
59 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
60 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
61 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
62 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
63 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
64 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
65 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
66 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
79 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
80 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
83 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
84 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
85 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
86 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
87 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
88 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
89 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.28
Metatranscriptomes 0
Isolates 26.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25
Nodule 1.72
Rhizoplane 2.59
Rhizosphere 43.97
Stem 0
Stem Tuber 0
Unclassified 26.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1001679 3300002737 Bacteria 10846
2 JGI25165J46597_1001245 3300003214 Bacteria 15077
3 Ga0055526_1006209 3300003771 Bacteria 6560
4 Ga0055524_1005812 3300003775 Bacteria 5448
5 Ga0055524_1005992 3300003775 Bacteria 5341
6 Ga0055528_1000092 3300003790 Bacteria 71565
7 Ga0065165_1004594 3300005262 Bacteria 8409
8 Ga0075365_10103232 3300006038 Bacteria 1954
9 Ga0209760_101744 3300025207 Bacteria 2190
10 Ga0209437_100033 3300025233 Bacteria 512520
11 Ga0209129_1002582 3300025258 Bacteria 8699
12 Ga0209233_1000152 3300025261 Bacteria 175910
13 Ga0209673_1000169 3300025273 Bacteria 134216
14 Ga0209673_1011472 3300025273 Bacteria 3650
15 Ga0209025_1000118 3300025294 Bacteria 214009
16 Ga0209025_1039179 3300025294 Bacteria 2071
17 Ga0209564_1000286 3300025295 Bacteria 102405
18 Ga0209758_1000486 3300025297 Bacteria 65083
19 Ga0209758_1021463 3300025297 Bacteria 3009
20 Ga0209256_1001031 3300025299 Bacteria 32723
21 Ga0209256_1004455 3300025299 Bacteria 8783
22 Ga0207426_1002467 3300025302 Bacteria 11771
23 Ga0265318_10033466 3300028577 Bacteria 1984
24 Ga0307515_10000420 3300028794 Bacteria 102216
25 Ga0307515_10010804 3300028794 Bacteria 17421
26 Ga0307515_10080612 3300028794 Bacteria 4242
27 Ga0265325_10021220 3300031241 Bacteria 3573
28 Ga0265340_10001720 3300031247 Bacteria 12552
29 Ga0265340_10035353 3300031247 Bacteria 2481
30 Ga0265339_10003158 3300031249 Bacteria 11595
31 Ga0265339_10049794 3300031249 Bacteria 2293
32 Ga0265316_10008968 3300031344 Bacteria 9222
33 Ga0307513_10004495 3300031456 Bacteria 18608
34 Ga0265313_10000031 3300031595 Bacteria 128981
35 Ga0265314_10024179 3300031711 Bacteria 4611
36 Ga0395905_0003119 3300037471 Bacteria 17874
37 Ga0395905_0009095 3300037471 Bacteria 9737
38 Ga0395905_0083248 3300037471 Bacteria 2997
39 Ga0495654_0000134 3300046530 Bacteria 77701
40 Ga0496110_0095912 3300048913 Bacteria 2657
41 Ga0496111_0007482 3300048914 Bacteria 7162
42 Ga0496117_0002003 3300048920 Bacteria 26991
43 Ga0496122_0000604 3300048925 Bacteria 73844
44 Ga0496123_0001019 3300048926 Bacteria 42794
45 Ga0496124_0004057 3300048927 Bacteria 17366
46 Ga0496124_0062034 3300048927 Bacteria 3130
47 Ga0496125_0002201 3300048928 Bacteria 26004
48 Ga0496126_0006318 3300048929 Bacteria 13229
49 Ga0496126_0010199 3300048929 Bacteria 9881
50 Ga0496126_0270845 3300048929 Bacteria 1409
51 Ga0501031_0000321 3300049568 Bacteria 27495
52 Ga0501031_0009373 3300049568 Bacteria 6364
53 Ga0501032_0000008 3300049569 Bacteria 240313
54 Ga0501032_0051330 3300049569 Bacteria 2781
55 Ga0501033_0000012 3300049570 Bacteria 241599
56 Ga0501033_0063446 3300049570 Bacteria 2719
57 Ga0501033_0111474 3300049570 Bacteria 1991
58 Ga0501034_0000035 3300049571 Bacteria 241623
59 Ga0501034_0062288 3300049571 Bacteria 3746
60 Ga0501036_0000006 3300049572 Bacteria 241623
61 Ga0501037_0000072 3300049573 Bacteria 94452
62 Ga0501038_0000007 3300049574 Bacteria 210775
63 Ga0501038_0051432 3300049574 Bacteria 3555
64 Ga0501039_0000012 3300049575 Bacteria 241623
65 Ga0501040_0001880 3300049576 Bacteria 13465
66 Ga0501043_0000211 3300049579 Bacteria 53464
67 Ga0501046_0028772 3300049580 Bacteria 4522
68 Ga0501047_0000380 3300049581 Bacteria 50128
69 Ga0501047_0135718 3300049581 Bacteria 2341
70 Ga0501047_0237652 3300049581 Bacteria 1673
71 Ga0501047_0300915 3300049581 Bacteria 1446
72 Ga0501070_0012989 3300049586 Bacteria 7020
73 Ga0501073_0126399 3300049589 Bacteria 1772
74 Ga0501035_0000035 3300049822 Bacteria 166916
75 Ga0501035_0011819 3300049822 Bacteria 8085
76 Ga0501035_0043096 3300049822 Bacteria 4068
77 Ga0501044_0000015 3300049823 Bacteria 241623
78 Ga0501045_0100150 3300049824 Bacteria 2145
79 nmdc:mga0yw44_523_c1 3300050492 Bacteria 13755
80 nmdc:mga0yw44_76064_c1 3300050492 Bacteria 2094
81 Ga0500618_000007 3300053125 Bacteria 226268
82 Ga0500658_0000863 3300053134 Bacteria 12435
83 Ga0500573_0000906 3300053140 Bacteria 13462
84 Ga0500573_0029465 3300053140 Bacteria 3163
85 Ga0500616_0000120 3300053153 Bacteria 142980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049589 Ga0501073_0126399 Ga0501073_0126399_374_1735 382
2 3300049822 Ga0501035_0043096 Ga0501035_0043096_947_2308 382
3 3300028794 Ga0307515_10080612 Ga0307515_100806123 394
4 3300049574 Ga0501038_0051432 Ga0501038_0051432_1541_2899 404
5 3300049581 Ga0501047_0237652 Ga0501047_0237652_291_1649 404
6 3300049581 Ga0501047_0300915 Ga0501047_0300915_31_1392 405
7 3300048929 Ga0496126_0010199 Ga0496126_0010199_138_1415 409
8 3300053140 Ga0500573_0000906 Ga0500573_0000906_10854_12254 412
9 3300053140 Ga0500573_0029465 Ga0500573_0029465_680_2056 414
10 3300037471 Ga0395905_0009095 Ga0395905_0009095_5870_7246 416
11 3300053125 Ga0500618_000007 Ga0500618_000007_127300_128691 416
12 3300053134 Ga0500658_0000863 Ga0500658_0000863_8279_9628 416
13 3300037471 Ga0395905_0083248 Ga0395905_0083248_1618_2958 417
14 3300046530 Ga0495654_0000134 Ga0495654_0000134_40661_42034 420
15 3300048914 Ga0496111_0007482 Ga0496111_0007482_5047_6420 420
16 iso_pu_bacteria 2643221637 2644206419 420
17 iso_pu_bacteria 2643221718 2644650066 420
18 3300049570 Ga0501033_0111474 Ga0501033_0111474_154_1500 421
19 3300048927 Ga0496124_0004057 Ga0496124_0004057_4949_6520 422
20 3300049568 Ga0501031_0009373 Ga0501031_0009373_2322_3686 422
21 3300025297 Ga0209758_1021463 Ga0209758_10214632 423
22 3300025294 Ga0209025_1000118 Ga0209025_1000118203 424
23 3300031247 Ga0265340_10001720 Ga0265340_1000172012 424
24 3300031249 Ga0265339_10003158 Ga0265339_100031583 424
25 3300031344 Ga0265316_10008968 Ga0265316_100089684 424
26 3300031595 Ga0265313_10000031 Ga0265313_1000003120 424
27 3300048928 Ga0496125_0002201 Ga0496125_0002201_9376_10953 424
28 3300049571 Ga0501034_0062288 Ga0501034_0062288_444_1799 424
29 3300053153 Ga0500616_0000120 Ga0500616_0000120_41360_42712 424
30 3300005262 Ga0065165_1004594 Ga0065165_10045946 425
31 3300048929 Ga0496126_0006318 Ga0496126_0006318_8283_9860 425
32 3300003771 Ga0055526_1006209 Ga0055526_10062092 426
33 3300003775 Ga0055524_1005812 Ga0055524_10058123 426
34 3300003775 Ga0055524_1005992 Ga0055524_10059924 426
35 3300003790 Ga0055528_1000092 Ga0055528_100009225 426
36 3300025273 Ga0209673_1000169 Ga0209673_100016986 426
37 3300025273 Ga0209673_1011472 Ga0209673_10114723 426
38 3300025294 Ga0209025_1039179 Ga0209025_10391791 426
39 3300025295 Ga0209564_1000286 Ga0209564_100028661 426
40 3300025299 Ga0209256_1001031 Ga0209256_100103126 426
41 3300025299 Ga0209256_1004455 Ga0209256_10044557 426
42 3300025302 Ga0207426_1002467 Ga0207426_10024675 426
43 3300048913 Ga0496110_0095912 Ga0496110_0095912_949_2367 426
44 3300048927 Ga0496124_0062034 Ga0496124_0062034_292_1665 426
45 3300048929 Ga0496126_0270845 Ga0496126_0270845_31_1392 426
46 iso_pu_bacteria 2894652903 2894655098 426
47 3300025258 Ga0209129_1002582 Ga0209129_10025822 427
48 3300025297 Ga0209758_1000486 Ga0209758_100048652 427
49 3300037471 Ga0395905_0003119 Ga0395905_0003119_459_1904 427
50 3300049569 Ga0501032_0051330 Ga0501032_0051330_964_2343 427
51 3300049822 Ga0501035_0011819 Ga0501035_0011819_2523_3902 427
52 3300006038 Ga0075365_10103232 Ga0075365_101032322 430
53 3300050492 nmdc:mga0yw44_76064_c1 nmdc:mga0yw44_76064_c1_615_1958 430
54 iso_pu_bacteria 2643221607 2644046811 431
55 iso_pu_bacteria 2643221636 2644202518 431
56 iso_pu_bacteria 2643221686 2644479600 431
57 iso_pu_bacteria 8054558443 8054560056 433
58 iso_pu_bacteria 2643221688 2644493592 434
59 iso_pu_bacteria 2854916844 2854921817 434
60 3300028577 Ga0265318_10033466 Ga0265318_100334662 435
61 3300031241 Ga0265325_10021220 Ga0265325_100212201 435
62 3300031249 Ga0265339_10049794 Ga0265339_100497942 435
63 3300031711 Ga0265314_10024179 Ga0265314_100241793 435
64 3300049581 Ga0501047_0135718 Ga0501047_0135718_738_2096 435
65 iso_pu_bacteria 2582581306 2585266454 435
66 iso_pu_bacteria 2582581865 2585387432 435
67 iso_pu_bacteria 2582581866 2585394092 435
68 iso_pu_bacteria 2842521101 2842525101 435
69 iso_pu_bacteria 2854896431 2854898583 435
70 iso_pu_bacteria 2989771324 2989775401 435
71 iso_pu_bacteria 3003930520 3003932389 435
72 3300028794 Ga0307515_10000420 Ga0307515_1000042036 436
73 3300031456 Ga0307513_10004495 Ga0307513_1000449520 436
74 3300050492 nmdc:mga0yw44_523_c1 nmdc:mga0yw44_523_c1_181_1551 436
75 iso_pu_bacteria 2510461069 2510840174 436
76 iso_pu_bacteria 2582581283 2585165317 436
77 iso_pu_bacteria 2600254933 2600374992 436
78 iso_pu_bacteria 2643221689 2644500747 436
79 iso_pu_bacteria 2775507049 2776912489 436
80 iso_pu_bacteria 2818991272 2819242854 436
81 iso_pu_bacteria 2818991461 2819684377 436
82 iso_pu_bacteria 2891373044 2891376444 436
83 iso_pu_bacteria 2899803654 2899806083 436
84 iso_pu_bacteria 2917554339 2917557699 436
85 iso_pu_bacteria 2989349275 2989355179 436
86 3300031247 Ga0265340_10035353 Ga0265340_100353532 437
87 iso_pu_bacteria 2738541317 2738945903 437
88 iso_pu_bacteria 2913308742 2913310412 437
89 3300028794 Ga0307515_10010804 Ga0307515_1001080414 439
90 iso_pu_bacteria 8056875544 8056879399 439
91 3300048920 Ga0496117_0002003 Ga0496117_0002003_21861_23438 440
92 3300048925 Ga0496122_0000604 Ga0496122_0000604_27509_29086 440
93 3300048926 Ga0496123_0001019 Ga0496123_0001019_8560_10137 440
94 3300049568 Ga0501031_0000321 Ga0501031_0000321_21990_23381 440
95 3300049569 Ga0501032_0000008 Ga0501032_0000008_25722_27113 440
96 3300049570 Ga0501033_0000012 Ga0501033_0000012_214511_215902 440
97 3300049570 Ga0501033_0063446 Ga0501033_0063446_401_1777 440
98 3300049571 Ga0501034_0000035 Ga0501034_0000035_214511_215902 440
99 3300049572 Ga0501036_0000006 Ga0501036_0000006_214511_215902 440
100 3300049573 Ga0501037_0000072 Ga0501037_0000072_25722_27113 440
101 3300049574 Ga0501038_0000007 Ga0501038_0000007_25722_27113 440
102 3300049575 Ga0501039_0000012 Ga0501039_0000012_214511_215902 440
103 3300049576 Ga0501040_0001880 Ga0501040_0001880_3216_4607 440
104 3300049579 Ga0501043_0000211 Ga0501043_0000211_25722_27113 440
105 3300049580 Ga0501046_0028772 Ga0501046_0028772_2033_3424 440
106 3300049581 Ga0501047_0000380 Ga0501047_0000380_27519_28910 440
107 3300049586 Ga0501070_0012989 Ga0501070_0012989_3912_5303 440
108 3300049822 Ga0501035_0000035 Ga0501035_0000035_139804_141195 440
109 3300049823 Ga0501044_0000015 Ga0501044_0000015_25722_27113 440
110 3300049824 Ga0501045_0100150 Ga0501045_0100150_233_1624 440
111 iso_pu_bacteria 2643221558 2643810260 440
112 3300002737 JGI25162J39368_1001679 JGI25162J39368_10016792 441
113 3300003214 JGI25165J46597_1001245 JGI25165J46597_10012456 441
114 3300025207 Ga0209760_101744 Ga0209760_1017442 441
115 3300025233 Ga0209437_100033 Ga0209437_10003375 441
116 3300025261 Ga0209233_1000152 Ga0209233_1000152104 441

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13229

Beta_helix

Right handed beta helix region

284

402

0.85

PF05048

NosD

Periplasmic copper-binding protein (NosD)

288

516

0.81

PF13229

Beta_helix

Right handed beta helix region

177

308

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eea-assembly1.cif.gz_C cyanophage pam1 tailspike receptor-binding domain 0.6355 30 416
7c7d-assembly2.cif.gz_B crystal structure of the catalytic unit of thermostable gh87 alpha-1,3-glucanase from streptomyces thermodiastaticus strain hf3-3 0.617 39 438
3gq7-assembly1.cif.gz_A crystal structure of the bacteriophage phi29 gene product 12 n-terminal fragment 0.6139 41 412
7eea-assembly1.cif.gz_B cyanophage pam1 tailspike receptor-binding domain 0.6071 30 412
3suc-assembly1.cif.gz_A crystal structure of the pre-mature bacteriophage phi29 gene product 12 0.6067 41 423
ID Description Score Start End Superfamily
af_Q7TPD1_723_883_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8125 156 259 3.30.40.10
af_Q9Z179_369_624_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.7409 73 232 2.160.20.10
af_Q54DF3_420_605_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.7315 96 327 2.160.20.10
af_A4I4X9_9_274_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.6969 64 349 2.160.20.10
af_A0A0R0F0K0_135_291_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.6911 38 155 2.160.20.10
ID Description Score Start End GO Terms
AF-A0A528FLY6-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9983 78 159
AF-A0A532AJ08-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9884 140 250
AF-A0A4R9VMB3-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9817 49 165
AF-A0A527GIF9-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9758 353 439
AF-A0A528FLY6-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9746 78 159

Feature Viewer

pLDDT pTM Quality
85.52 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map