F084256

General Info

Members Datasets Scaffolds Average Seq Length
115 90 230 169

Family's Representative Sequence

Representative Sequence 3300030522|Ga0307512_10241005|Ga0307512_102410052
Length 205
Sequence MLVKEKIGNLKAAAIGNQTIDWLDLQWYEANKRIMHKRSRSGTEVVMKFLNENQNLTQDDILYQDNENIIAINILACEVLIIKPKNMFEMASICYEIGNKHLPLFYQDDEVLVAFDAPLFRLISSSGYEAEKGERKLINPLRTSVAAHGHASSGSSETLFSKIMRLTNSQERTPNCSAFYNSPTQLCLSAVSPTHQGWKRMCRPV

Samples

Sample ID Description Type Environment
1 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
41 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
42 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
57 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
58 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
59 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
60 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
63 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
64 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
65 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
66 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
70 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
71 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
72 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
73 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
74 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
75 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
76 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
77 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
78 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
79 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
80 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
81 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
82 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
83 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
84 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
85 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
86 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
87 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
88 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
89 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
90 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.52
Nodule 0
Rhizoplane 0.87
Rhizosphere 70.43
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307512_10241005 3300030522 Bacteria 915
2 rootH1_10021978 3300003316 Bacteria 2631
3 rootH2_10196403 3300003320 Bacteria 1922
4 rootH1_10318025 3300003323 Bacteria 1132
5 Ga0065715_10407127 3300005293 Unclassified 874
6 Ga0070670_100045418 3300005331 Bacteria 3777
7 Ga0070670_100153406 3300005331 Unclassified 1994
8 Ga0070670_100185065 3300005331 Bacteria 1808
9 Ga0070677_10282029 3300005333 Bacteria 837
10 Ga0070682_100206217 3300005337 Bacteria 1390
11 Ga0070660_100041979 3300005339 Bacteria 3489
12 Ga0070671_100360428 3300005355 Bacteria 1241
13 Ga0070674_100236014 3300005356 Bacteria 1429
14 Ga0070659_100000092 3300005366 Bacteria 67270
15 Ga0070667_100033490 3300005367 Bacteria 4295
16 Ga0070667_100365196 3300005367 Bacteria 1309
17 Ga0070708_101019183 3300005445 Unclassified 776
18 Ga0070678_100322163 3300005456 Unclassified 1320
19 Ga0070698_100062288 3300005471 Bacteria 3763
20 Ga0068853_100935511 3300005539 Bacteria 833
21 Ga0070672_100486387 3300005543 Bacteria 1066
22 Ga0068855_100303942 3300005563 Bacteria 1766
23 Ga0068857_100980970 3300005577 Unclassified 813
24 Ga0068854_100787340 3300005578 Unclassified 828
25 Ga0068852_101776097 3300005616 Bacteria 639
26 Ga0068851_10300409 3300005834 Bacteria 923
27 Ga0068870_10524812 3300005840 Bacteria 793
28 Ga0068860_100300904 3300005843 Bacteria 1571
29 Ga0068860_100835851 3300005843 Bacteria 935
30 Ga0075366_10011674 3300006195 Bacteria 4963
31 Ga0075366_10067599 3300006195 Bacteria 2127
32 Ga0068871_100015303 3300006358 Bacteria 5738
33 Ga0105240_10160416 3300009093 Bacteria 2671
34 Ga0105240_10234184 3300009093 Bacteria 2132
35 Ga0105241_10064591 3300009174 Unclassified 2826
36 Ga0105241_10997017 3300009174 Unclassified 783
37 Ga0105237_10018207 3300009545 Bacteria 7270
38 Ga0105238_10457213 3300009551 Bacteria 1274
39 Ga0105239_10000512 3300010375 Bacteria 56021
40 Ga0157373_10000087 3300013100 Bacteria 80308
41 Ga0157374_10054844 3300013296 Bacteria 3719
42 Ga0157372_10060726 3300013307 Bacteria 4230
43 Ga0157372_11028824 3300013307 Unclassified 954
44 Ga0157375_10054960 3300013308 Unclassified 3923
45 Ga0157375_10491427 3300013308 Bacteria 1392
46 Ga0157375_12464289 3300013308 Bacteria 621
47 Ga0157380_10125029 3300014326 Bacteria 2184
48 Ga0157380_11045030 3300014326 Bacteria 853
49 Ga0157379_10100889 3300014968 Bacteria 2591
50 Ga0157376_10144620 3300014969 Bacteria 2137
51 Ga0209646_1001491 3300025246 Bacteria 6230
52 Ga0209026_1000505 3300025250 Bacteria 27798
53 Ga0207680_10097372 3300025903 Bacteria 1884
54 Ga0207671_10062285 3300025914 Bacteria 2770
55 Ga0207657_10119031 3300025919 Bacteria 2174
56 Ga0207650_10282199 3300025925 Bacteria 1353
57 Ga0207650_10398978 3300025925 Bacteria 1138
58 Ga0207650_11167751 3300025925 Unclassified 655
59 Ga0207690_10000309 3300025932 Bacteria 33416
60 Ga0207691_10077188 3300025940 Unclassified 3001
61 Ga0207691_10462681 3300025940 Bacteria 1079
62 Ga0207667_10281932 3300025949 Bacteria 1698
63 Ga0207640_10433380 3300025981 Archaea 1079
64 Ga0207658_10120990 3300025986 Bacteria 2087
65 Ga0207658_10472727 3300025986 Bacteria 1113
66 Ga0207639_10825788 3300026041 Bacteria 864
67 Ga0207702_10032527 3300026078 Bacteria 4353
68 Ga0207648_10642705 3300026089 Bacteria 980
69 Ga0207674_10013652 3300026116 Bacteria 8996
70 Ga0207675_100569257 3300026118 Bacteria 1133
71 Ga0307509_10006991 3300031507 Bacteria 14957
72 Ga0307509_10082614 3300031507 Bacteria 3314
73 Ga0307509_10640892 3300031507 Unclassified 732
74 Ga0307508_10001325 3300031616 Bacteria 28026
75 Ga0307516_10353922 3300031730 Unclassified 1134
76 Ga0307518_10190487 3300031838 Bacteria 1375
77 Ga0373927_0458317 3300035695 Unclassified 842
78 Ga0373925_0245195 3300037068 Bacteria 1436
79 Ga0451787_296298 3300041441 Unclassified 808
80 Ga0451841_1281808 3300041498 Unclassified 707
81 Ga0451855_1018364 3300041511 Unclassified 908
82 Ga0466972_0063447 3300044658 Bacteria 1769
83 Ga0466972_0238570 3300044658 Bacteria 851
84 Ga0466968_0076478 3300044735 Unclassified 1465
85 Ga0466968_0383940 3300044735 Bacteria 686
86 Ga0466957_0002264 3300044842 Bacteria 10313
87 Ga0495606_0019464 3300046507 Bacteria 5051
88 Ga0495648_0329461 3300046524 Unclassified 705
89 Ga0495669_0328146 3300046684 Bacteria 739
90 Ga0495686_0000772 3300047472 Bacteria 42035
91 Ga0495686_0022375 3300047472 Bacteria 4184
92 Ga0495686_0247716 3300047472 Bacteria 1002
93 Ga0495686_0490267 3300047472 Unclassified 648
94 Ga0495602_0994152 3300048088 Bacteria 554
95 Ga0501238_004261 3300049671 Bacteria 1783
96 Ga0501257_030815 3300049686 Bacteria 1292
97 nmdc:mga0k408_786422_c1 3300050493 Bacteria 555
98 nmdc:mga05p37_5921_c1 3300050507 Bacteria 14385
99 Ga0500578_0000034 3300053086 Bacteria 136582
100 Ga0500578_0014371 3300053086 Bacteria 5092
101 Ga0500646_0018150 3300053090 Bacteria 1851
102 Ga0500646_0040052 3300053090 Bacteria 1316
103 Ga0500583_0018858 3300053092 Bacteria 2814
104 Ga0500651_0370838 3300053093 Bacteria 809
105 Ga0500641_0013149 3300053096 Bacteria 3038
106 Ga0500554_096457 3300053102 Bacteria 986
107 Ga0500652_148544 3300053131 Bacteria 973
108 Ga0500568_0000088 3300053139 Bacteria 89215
109 Ga0500588_0000901 3300053146 Bacteria 5233
110 Ga0500616_0007156 3300053153 Bacteria 7137
111 Ga0500622_0066134 3300053156 Bacteria 1836
112 Ga0500622_0094985 3300053156 Unclassified 1474
113 Ga0500611_000013 3300053727 Bacteria 135447
114 Ga0500587_021961 3300053739 Unclassified 838
115 Ga0466962_0214599 3300061719 Bacteria 942
116 Ga0307512_10241005
117 rootH1_10021978
118 rootH2_10196403
119 rootH1_10318025
120 Ga0065715_10407127
121 Ga0070670_100045418
122 Ga0070670_100153406
123 Ga0070670_100185065
124 Ga0070677_10282029
125 Ga0070682_100206217
126 Ga0070660_100041979
127 Ga0070671_100360428
128 Ga0070674_100236014
129 Ga0070659_100000092
130 Ga0070667_100033490
131 Ga0070667_100365196
132 Ga0070708_101019183
133 Ga0070678_100322163
134 Ga0070698_100062288
135 Ga0068853_100935511
136 Ga0070672_100486387
137 Ga0068855_100303942
138 Ga0068857_100980970
139 Ga0068854_100787340
140 Ga0068852_101776097
141 Ga0068851_10300409
142 Ga0068870_10524812
143 Ga0068860_100300904
144 Ga0068860_100835851
145 Ga0075366_10011674
146 Ga0075366_10067599
147 Ga0068871_100015303
148 Ga0105240_10160416
149 Ga0105240_10234184
150 Ga0105241_10064591
151 Ga0105241_10997017
152 Ga0105237_10018207
153 Ga0105238_10457213
154 Ga0105239_10000512
155 Ga0157373_10000087
156 Ga0157374_10054844
157 Ga0157372_10060726
158 Ga0157372_11028824
159 Ga0157375_10054960
160 Ga0157375_10491427
161 Ga0157375_12464289
162 Ga0157380_10125029
163 Ga0157380_11045030
164 Ga0157379_10100889
165 Ga0157376_10144620
166 Ga0209646_1001491
167 Ga0209026_1000505
168 Ga0207680_10097372
169 Ga0207671_10062285
170 Ga0207657_10119031
171 Ga0207650_10282199
172 Ga0207650_10398978
173 Ga0207650_11167751
174 Ga0207690_10000309
175 Ga0207691_10077188
176 Ga0207691_10462681
177 Ga0207667_10281932
178 Ga0207640_10433380
179 Ga0207658_10120990
180 Ga0207658_10472727
181 Ga0207639_10825788
182 Ga0207702_10032527
183 Ga0207648_10642705
184 Ga0207674_10013652
185 Ga0207675_100569257
186 Ga0307509_10006991
187 Ga0307509_10082614
188 Ga0307509_10640892
189 Ga0307508_10001325
190 Ga0307516_10353922
191 Ga0307518_10190487
192 Ga0373927_0458317
193 Ga0373925_0245195
194 Ga0451787_296298
195 Ga0451841_1281808
196 Ga0451855_1018364
197 Ga0466972_0063447
198 Ga0466972_0238570
199 Ga0466968_0076478
200 Ga0466968_0383940
201 Ga0466957_0002264
202 Ga0495606_0019464
203 Ga0495648_0329461
204 Ga0495669_0328146
205 Ga0495686_0000772
206 Ga0495686_0022375
207 Ga0495686_0247716
208 Ga0495686_0490267
209 Ga0495602_0994152
210 Ga0501238_004261
211 Ga0501257_030815
212 nmdc:mga0k408_786422_c1
213 nmdc:mga05p37_5921_c1
214 Ga0500578_0000034
215 Ga0500578_0014371
216 Ga0500646_0018150
217 Ga0500646_0040052
218 Ga0500583_0018858
219 Ga0500651_0370838
220 Ga0500641_0013149
221 Ga0500554_096457
222 Ga0500652_148544
223 Ga0500568_0000088
224 Ga0500588_0000901
225 Ga0500616_0007156
226 Ga0500622_0066134
227 Ga0500622_0094985
228 Ga0500611_000013
229 Ga0500587_021961
230 Ga0466962_0214599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02814

UreE_N

UreE urease accessory protein, N-terminal domain

9

70

0.93

PF05194

UreE_C

UreE urease accessory protein, C-terminal domain

77

158

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tj8-assembly1.cif.gz_A crystal structure of helicobacter pylori uree bound to ni2+ 0.9373 1 144
3la0-assembly2.cif.gz_B crystal structure of uree from helicobacter pylori (metal of unknown identity bound) 0.9014 1 146
3tj8-assembly1.cif.gz_A crystal structure of helicobacter pylori uree bound to ni2+ 0.9014 1 144
3la0-assembly2.cif.gz_B crystal structure of uree from helicobacter pylori (metal of unknown identity bound) 0.8786 1 146
4l3k-assembly1.cif.gz_B crystal structure of sporosarcina pasteurii uree bound to ni2+ and zn2+ 0.8469 1 142
ID Description Score Start End Superfamily
af_Q2G2K8_1_75_2.60.260.20 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.9319 1 74 2.60.260.20
af_Q2G2K8_1_75_2.60.260.20 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.9084 1 74 2.60.260.20
3tjaD01 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.9063 1 74 2.60.260.20
3ny0C02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;UreE, C-terminal domain 0.8996 75 144 3.30.70.790
3tjaD01 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.8839 1 74 2.60.260.20
ID Description Score Start End GO Terms
AF-A0A7X6XCW0-F1-model_v4 Urease accessory protein UreE 0.9575 1 108 GO:0005737
GO:0006457
GO:0016151
AF-A0A7X6XCW0-F1-model_v4 Urease accessory protein UreE 0.949 1 108 GO:0005737
GO:0006457
GO:0016151
AF-A0A086YT39-F1-model_v4 Urease accessory protein UreE 0.9467 1 144 GO:0005737
GO:0006457
GO:0016151
GO:0019627
GO:0051082
GO:0065003
AF-A0A1W1XWL7-F1-model_v4 Urease accessory protein UreE 0.9438 1 148 GO:0005737
GO:0006457
GO:0016151
GO:0019627
GO:0051082
GO:0065003
AF-A0A4Q5R5W0-F1-model_v4 Urease accessory protein UreE 0.9419 1 142 GO:0005737
GO:0006457
GO:0016151
GO:0019627
GO:0065003

Map