F083034

General Info

Members Datasets Scaffolds Average Seq Length
115 61 115 201

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10817543|Ga0070717_108175431
Length 226
Sequence MKRAIRHLQQADPVMAGIIERIGPFKMRYREPSFDAMARSIVFQQLHGKAAATIFERVRTACLGGNGLCGPGSLTRAGRGEAPSPYKQDGLTPASILALSEEQLRACGLSRQKLSYLRDLAQRTASGEIDFARLQEMSDEDVIEHLTRVKGIGVWSAQMFLIFALRRLNVMPTVDYGINFAIKKAYRKRQMPKPKQILKISRPWHPYCSVACWYLWRYAELKDAKK

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
14 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
17 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
20 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
21 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
31 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
32 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
33 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
34 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
35 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
36 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
39 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
40 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
41 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
42 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
43 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
44 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
45 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
46 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
47 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
48 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
49 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
50 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
51 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
52 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
53 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
55 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
56 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
57 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
58 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
59 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
60 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
61 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.74
Rhizosphere 73.04
Stem 0
Stem Tuber 0
Unclassified 25.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100018397 3300005336 Bacteria 5519
2 Ga0070680_100501517 3300005336 Bacteria 1038
3 Ga0070692_10282056 3300005345 Bacteria 1007
4 Ga0070714_100307449 3300005435 Bacteria 1479
5 Ga0070714_100495024 3300005435 Bacteria 1165
6 Ga0070714_100627474 3300005435 Bacteria 1033
7 Ga0070713_100380549 3300005436 Unclassified 1315
8 Ga0070713_100602521 3300005436 Bacteria 1044
9 Ga0070663_100532238 3300005455 Bacteria 980
10 Ga0070681_10000886 3300005458 Bacteria 25274
11 Ga0070681_10096585 3300005458 Unclassified 2903
12 Ga0070681_10547335 3300005458 Bacteria 1071
13 Ga0070679_100002997 3300005530 Bacteria 15417
14 Ga0070679_100023414 3300005530 Bacteria 6045
15 Ga0070679_100126994 3300005530 Bacteria 2532
16 Ga0070695_100097601 3300005545 Unclassified 1973
17 Ga0068854_100017093 3300005578 Bacteria 4850
18 Ga0068856_100070372 3300005614 Bacteria 3461
19 Ga0068856_100332152 3300005614 Bacteria 1538
20 Ga0068856_100684157 3300005614 Unclassified 1046
21 Ga0081455_10091915 3300005937 Bacteria 2456
22 Ga0070717_10390253 3300006028 Unclassified 1249
23 Ga0070717_10817543 3300006028 Unclassified 848
24 Ga0075436_100009938 3300006914 Bacteria 6507
25 Ga0075436_100125999 3300006914 Bacteria 1794
26 Ga0075436_100127073 3300006914 Bacteria 1786
27 Ga0075435_100291328 3300007076 Bacteria 1395
28 Ga0075435_100455932 3300007076 Bacteria 1103
29 Ga0105240_10072304 3300009093 Bacteria 4262
30 Ga0157373_10156935 3300013100 Bacteria 1600
31 Ga0157370_10034024 3300013104 Bacteria 4966
32 Ga0157369_10056784 3300013105 Unclassified 4224
33 Ga0157369_10209285 3300013105 Bacteria 2045
34 Ga0157369_10318411 3300013105 Bacteria 1617
35 Ga0213872_10000901 3300021361 Bacteria 21377
36 Ga0213875_10002076 3300021388 Bacteria 12283
37 Ga0213875_10142236 3300021388 Unclassified 1123
38 Ga0213875_10213664 3300021388 Unclassified 908
39 Ga0213875_10223615 3300021388 Bacteria 887
40 Ga0224712_10029084 3300022467 Bacteria 1981
41 Ga0207707_10011781 3300025912 Bacteria 7607
42 Ga0207707_10737749 3300025912 Bacteria 824
43 Ga0207660_10009482 3300025917 Bacteria 6301
44 Ga0207660_10313076 3300025917 Bacteria 1252
45 Ga0207652_10034468 3300025921 Bacteria 4266
46 Ga0207652_10062354 3300025921 Unclassified 3221
47 Ga0207652_10308156 3300025921 Bacteria 1429
48 Ga0207700_10403143 3300025928 Bacteria 1199
49 Ga0207661_10290348 3300025944 Bacteria 1464
50 Ga0207640_10017107 3300025981 Bacteria 4235
51 Ga0207678_10039604 3300026067 Bacteria 4090
52 Ga0207702_11227528 3300026078 Unclassified 744
53 Ga0265325_10001167 3300031241 Bacteria 18764
54 Ga0265325_10127627 3300031241 Unclassified 1221
55 Ga0265316_10643209 3300031344 Bacteria 750
56 Ga0265313_10059245 3300031595 Unclassified 1802
57 Ga0265313_10175802 3300031595 Unclassified 902
58 Ga0373935_0014497 3300035692 Bacteria 4757
59 Ga0373927_0129087 3300035695 Bacteria 1651
60 Ga0373937_0510675 3300036401 Unclassified 1142
61 Ga0373925_0651534 3300037068 Bacteria 868
62 Ga0395900_0137550 3300037418 Bacteria 2503
63 Ga0395905_0625075 3300037471 Bacteria 979
64 Ga0436364_0056191 3300037853 Bacteria 23209
65 Ga0436364_0534287 3300037853 Unclassified 887
66 Ga0436364_0539510 3300037853 Unclassified 691
67 Ga0436364_0663722 3300037853 Bacteria 631
68 Ga0436364_0741180 3300037853 Bacteria 2486
69 Ga0436364_0823910 3300037853 Bacteria 5239
70 Ga0436364_0924610 3300037853 Unclassified 2037
71 Ga0436364_1027481 3300037853 Bacteria 33875
72 Ga0436364_1044075 3300037853 Unclassified 1021
73 Ga0436364_1324949 3300037853 Unclassified 895
74 Ga0436364_1330151 3300037853 Bacteria 3007
75 Ga0436364_1469294 3300037853 Bacteria 8437
76 Ga0436365_0195314 3300039437 Unclassified 2974
77 Ga0436365_0273569 3300039437 Bacteria 1624
78 Ga0436365_0668703 3300039437 Bacteria 3424
79 Ga0436365_0679225 3300039437 Unclassified 961
80 Ga0436365_0906322 3300039437 Bacteria 1194
81 Ga0436365_0926579 3300039437 Unclassified 723
82 Ga0436365_1429932 3300039437 Unclassified 781
83 Ga0436365_1662506 3300039437 Bacteria 892
84 Ga0436360_1293391 3300039438 Unclassified 1407
85 Ga0436361_0685611 3300039447 Unclassified 855
86 Ga0436361_0779674 3300039447 Bacteria 61407
87 Ga0436361_0881369 3300039447 Unclassified 1186
88 Ga0436363_0191479 3300039450 Unclassified 909
89 Ga0436363_0770340 3300039450 Unclassified 926
90 Ga0436363_0851867 3300039450 Bacteria 1868
91 Ga0436363_1547096 3300039450 Unclassified 1116
92 Ga0436363_1641486 3300039450 Unclassified 708
93 Ga0436362_0145797 3300039453 Bacteria 973
94 Ga0436362_0150671 3300039453 Bacteria 987
95 Ga0436362_0708196 3300039453 Unclassified 781
96 Ga0466958_0321215 3300045836 Bacteria 995
97 Ga0466967_1006573 3300045976 Unclassified 830
98 Ga0496104_0205365 3300048907 Bacteria 1882
99 Ga0496113_0764208 3300048916 Unclassified 769
100 Ga0501034_0031164 3300049571 Bacteria 5419
101 Ga0501037_0425648 3300049573 Unclassified 908
102 Ga0501038_0573250 3300049574 Unclassified 856
103 Ga0501043_0132636 3300049579 Bacteria 1952
104 Ga0501046_0027726 3300049580 Bacteria 4618
105 Ga0501047_0034982 3300049581 Bacteria 4851
106 Ga0501070_0002154 3300049586 Bacteria 17307
107 Ga0501073_0449845 3300049589 Unclassified 890
108 Ga0501080_0101164 3300049742 Bacteria 2674
109 Ga0501035_0050262 3300049822 Unclassified 3736
110 nmdc:mga0n895_333638_c1 3300050512 Bacteria 1536
111 nmdc:mga0rr50_251058_c1 3300050513 Bacteria 1469
112 nmdc:mga0rr50_488843_c1 3300050513 Bacteria 1046
113 nmdc:mga08x19_172359_c1 3300050514 Bacteria 1474
114 nmdc:mga08x19_6027_c1 3300050514 Bacteria 7167
115 nmdc:mga08x19_90894_c1 3300050514 Bacteria 2015

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0014497 Ga0373935_0014497_803_1363 166
2 3300035695 Ga0373927_0129087 Ga0373927_0129087_852_1412 166
3 3300039447 Ga0436361_0685611 Ga0436361_0685611_38_556 172
4 3300039437 Ga0436365_0273569 Ga0436365_0273569_80_601 173
5 3300039437 Ga0436365_0906322 Ga0436365_0906322_80_601 173
6 3300039450 Ga0436363_0191479 Ga0436363_0191479_331_852 173
7 3300037068 Ga0373925_0651534 Ga0373925_0651534_186_710 174
8 3300039437 Ga0436365_0195314 Ga0436365_0195314_1240_1764 174
9 3300039450 Ga0436363_0770340 Ga0436363_0770340_280_804 174
10 3300005614 Ga0068856_100070372 Ga0068856_1000703722 181
11 3300039453 Ga0436362_0150671 Ga0436362_0150671_271_825 184
12 3300005345 Ga0070692_10282056 Ga0070692_102820562 185
13 3300005455 Ga0070663_100532238 Ga0070663_1005322381 185
14 3300005458 Ga0070681_10547335 Ga0070681_105473352 185
15 3300013100 Ga0157373_10156935 Ga0157373_101569352 185
16 3300022467 Ga0224712_10029084 Ga0224712_100290842 185
17 3300025912 Ga0207707_10737749 Ga0207707_107377491 185
18 3300021388 Ga0213875_10142236 Ga0213875_101422362 186
19 3300037853 Ga0436364_0539510 Ga0436364_0539510_92_652 186
20 3300037853 Ga0436364_0663722 Ga0436364_0663722_33_593 186
21 3300037853 Ga0436364_1324949 Ga0436364_1324949_35_595 186
22 3300039438 Ga0436360_1293391 Ga0436360_1293391_328_888 186
23 3300039447 Ga0436361_0779674 Ga0436361_0779674_3128_3688 186
24 3300021361 Ga0213872_10000901 Ga0213872_1000090115 187
25 3300037853 Ga0436364_0823910 Ga0436364_0823910_56_658 192
26 3300048907 Ga0496104_0205365 Ga0496104_0205365_323_1018 197
27 3300048916 Ga0496113_0764208 Ga0496113_0764208_39_734 197
28 3300007076 Ga0075435_100455932 Ga0075435_1004559321 199
29 3300005336 Ga0070680_100501517 Ga0070680_1005015172 200
30 3300005435 Ga0070714_100307449 Ga0070714_1003074492 200
31 3300005435 Ga0070714_100495024 Ga0070714_1004950242 200
32 3300005435 Ga0070714_100627474 Ga0070714_1006274741 200
33 3300005436 Ga0070713_100380549 Ga0070713_1003805492 200
34 3300005436 Ga0070713_100602521 Ga0070713_1006025211 200
35 3300005530 Ga0070679_100023414 Ga0070679_1000234143 200
36 3300005545 Ga0070695_100097601 Ga0070695_1000976011 200
37 3300005614 Ga0068856_100332152 Ga0068856_1003321521 200
38 3300005614 Ga0068856_100684157 Ga0068856_1006841571 200
39 3300005937 Ga0081455_10091915 Ga0081455_100919152 200
40 3300006028 Ga0070717_10390253 Ga0070717_103902532 200
41 3300006914 Ga0075436_100009938 Ga0075436_1000099385 200
42 3300006914 Ga0075436_100125999 Ga0075436_1001259992 200
43 3300006914 Ga0075436_100127073 Ga0075436_1001270732 200
44 3300007076 Ga0075435_100291328 Ga0075435_1002913282 200
45 3300009093 Ga0105240_10072304 Ga0105240_100723044 200
46 3300013104 Ga0157370_10034024 Ga0157370_100340247 200
47 3300013105 Ga0157369_10056784 Ga0157369_100567845 200
48 3300013105 Ga0157369_10318411 Ga0157369_103184112 200
49 3300021388 Ga0213875_10002076 Ga0213875_100020763 200
50 3300021388 Ga0213875_10213664 Ga0213875_102136642 200
51 3300021388 Ga0213875_10223615 Ga0213875_102236151 200
52 3300025921 Ga0207652_10308156 Ga0207652_103081562 200
53 3300026067 Ga0207678_10039604 Ga0207678_100396042 200
54 3300026078 Ga0207702_11227528 Ga0207702_112275281 200
55 3300036401 Ga0373937_0510675 Ga0373937_0510675_278_880 200
56 3300037418 Ga0395900_0137550 Ga0395900_0137550_1776_2378 200
57 3300037471 Ga0395905_0625075 Ga0395905_0625075_65_667 200
58 3300037853 Ga0436364_0056191 Ga0436364_0056191_8678_9280 200
59 3300037853 Ga0436364_0534287 Ga0436364_0534287_207_809 200
60 3300037853 Ga0436364_0741180 Ga0436364_0741180_590_1192 200
61 3300037853 Ga0436364_0924610 Ga0436364_0924610_377_979 200
62 3300037853 Ga0436364_1027481 Ga0436364_1027481_18504_19106 200
63 3300037853 Ga0436364_1044075 Ga0436364_1044075_27_629 200
64 3300037853 Ga0436364_1330151 Ga0436364_1330151_371_973 200
65 3300037853 Ga0436364_1469294 Ga0436364_1469294_456_1058 200
66 3300039437 Ga0436365_0668703 Ga0436365_0668703_2369_2971 200
67 3300039437 Ga0436365_0926579 Ga0436365_0926579_14_616 200
68 3300039437 Ga0436365_1429932 Ga0436365_1429932_93_695 200
69 3300039437 Ga0436365_1662506 Ga0436365_1662506_93_698 200
70 3300039447 Ga0436361_0881369 Ga0436361_0881369_251_853 200
71 3300039450 Ga0436363_0851867 Ga0436363_0851867_920_1522 200
72 3300039450 Ga0436363_1547096 Ga0436363_1547096_288_890 200
73 3300039450 Ga0436363_1641486 Ga0436363_1641486_55_657 200
74 3300039453 Ga0436362_0145797 Ga0436362_0145797_30_632 200
75 3300039453 Ga0436362_0708196 Ga0436362_0708196_32_634 200
76 3300045836 Ga0466958_0321215 Ga0466958_0321215_286_888 200
77 3300045976 Ga0466967_1006573 Ga0466967_1006573_58_660 200
78 3300049571 Ga0501034_0031164 Ga0501034_0031164_3118_3726 200
79 3300049573 Ga0501037_0425648 Ga0501037_0425648_43_651 200
80 3300049574 Ga0501038_0573250 Ga0501038_0573250_188_796 200
81 3300049579 Ga0501043_0132636 Ga0501043_0132636_1139_1747 200
82 3300049580 Ga0501046_0027726 Ga0501046_0027726_1507_2115 200
83 3300049581 Ga0501047_0034982 Ga0501047_0034982_2452_3060 200
84 3300049586 Ga0501070_0002154 Ga0501070_0002154_1517_2125 200
85 3300049589 Ga0501073_0449845 Ga0501073_0449845_203_811 200
86 3300049742 Ga0501080_0101164 Ga0501080_0101164_398_1006 200
87 3300049822 Ga0501035_0050262 Ga0501035_0050262_1272_1880 200
88 3300050512 nmdc:mga0n895_333638_c1 nmdc:mga0n895_333638_c1_184_852 200
89 3300050513 nmdc:mga0rr50_251058_c1 nmdc:mga0rr50_251058_c1_735_1358 200
90 3300050513 nmdc:mga0rr50_488843_c1 nmdc:mga0rr50_488843_c1_23_691 200
91 3300050514 nmdc:mga08x19_172359_c1 nmdc:mga08x19_172359_c1_43_666 200
92 3300050514 nmdc:mga08x19_6027_c1 nmdc:mga08x19_6027_c1_2561_3229 200
93 3300050514 nmdc:mga08x19_90894_c1 nmdc:mga08x19_90894_c1_684_1307 200
94 3300006028 Ga0070717_10817543 Ga0070717_108175431 201
95 3300025928 Ga0207700_10403143 Ga0207700_104031431 201
96 3300031241 Ga0265325_10001167 Ga0265325_1000116714 201
97 3300031241 Ga0265325_10127627 Ga0265325_101276271 201
98 3300031344 Ga0265316_10643209 Ga0265316_106432092 201
99 3300031595 Ga0265313_10059245 Ga0265313_100592452 201
100 3300031595 Ga0265313_10175802 Ga0265313_101758022 201
101 3300005458 Ga0070681_10096585 Ga0070681_100965854 203
102 3300005530 Ga0070679_100126994 Ga0070679_1001269943 203
103 3300013105 Ga0157369_10209285 Ga0157369_102092853 203
104 3300025917 Ga0207660_10313076 Ga0207660_103130761 203
105 3300025944 Ga0207661_10290348 Ga0207661_102903482 203
106 3300039437 Ga0436365_0679225 Ga0436365_0679225_234_854 203
107 3300025921 Ga0207652_10034468 Ga0207652_100344685 204
108 3300005578 Ga0068854_100017093 Ga0068854_1000170932 206
109 3300025981 Ga0207640_10017107 Ga0207640_100171076 206
110 3300005336 Ga0070680_100018397 Ga0070680_1000183974 210
111 3300005458 Ga0070681_10000886 Ga0070681_100008864 210
112 3300005530 Ga0070679_100002997 Ga0070679_1000029974 210
113 3300025912 Ga0207707_10011781 Ga0207707_100117816 210
114 3300025917 Ga0207660_10009482 Ga0207660_100094822 210
115 3300025921 Ga0207652_10062354 Ga0207652_100623544 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

38

206

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b21-assembly1.cif.gz_A unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2 0.9287 3 201
3s6i-assembly1.cif.gz_A schizosaccaromyces pombe 3-methyladenine dna glycosylase (mag1) in complex with abasic-dna. 0.9128 6 206
4b21-assembly1.cif.gz_A unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2 0.8906 3 201
3s6i-assembly1.cif.gz_A schizosaccaromyces pombe 3-methyladenine dna glycosylase (mag1) in complex with abasic-dna. 0.888 6 206
2h56-assembly2.cif.gz_B crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution 0.8747 5 199
ID Description Score Start End Superfamily
af_B4FZ58_120_231_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9539 39 148 1.10.340.30
af_Q92383_49_162_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9346 37 148 1.10.340.30
af_A0A1D8PI96_136_252_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9336 38 146 1.10.340.30
af_B4FZ58_120_231_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9295 39 148 1.10.340.30
2yg8A02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9181 38 148 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A7V9G9P9-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9847 4 206 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A1F2RU23-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9806 6 201 GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-T1BD48-F1-model_v4 DNA-3-methyladenine glycosylase II 0.9767 50 202 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A7C2KKX3-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9766 7 202 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A150FQL8-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9765 7 202 GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916

Feature Viewer

pLDDT pTM Quality
91.51 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map