F082669

General Info

Members Datasets Scaffolds Average Seq Length
115 79 109 156

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100407361|Ga0070699_1004073612
Length 171
Sequence VLKPGDPAPDFRLPSSSGKEVGLRDLRGRHVVLYFYPKDDTPGCTREACDFRDRVSKLRSAGAEVLGISKDSMGSHQSFVEKYDLTFPLLTDGDNRVSSAYGAYGEKVLYGRRFMGTIRSTFLIDPKGRVQAVWSPVKVDGHADAVLARLKGEEPTKASSKRPKVPGQRRR

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
3 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
4 2739367700 Dyella sp. YR388 Isolate Unclassified
5 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
6 2928963466 Dyella japonica 1073 Isolate Unclassified
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
57 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
58 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
59 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
60 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
63 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
64 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
65 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
66 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
70 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
71 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
72 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
73 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
74 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
75 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
76 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
78 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
79 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.57
Metatranscriptomes 5.22
Isolates 5.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.87
Rhizosphere 93.91
Stem 0
Stem Tuber 0
Unclassified 5.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11517007 3300004799 Bacteria 795
2 Ga0070658_10141951 3300005327 Bacteria 2007
3 Ga0070690_100267186 3300005330 Bacteria 1215
4 Ga0070690_100777099 3300005330 Bacteria 741
5 Ga0070670_100344433 3300005331 Bacteria 1309
6 Ga0070689_100286959 3300005340 Unclassified 1367
7 Ga0070713_100267384 3300005436 Bacteria 1565
8 Ga0070663_100187065 3300005455 Bacteria 1610
9 Ga0070678_100619750 3300005456 Bacteria 968
10 Ga0070707_100221372 3300005468 Bacteria 1843
11 Ga0070699_100407361 3300005518 Bacteria 1230
12 Ga0068853_100423604 3300005539 Bacteria 1248
13 Ga0068855_100595321 3300005563 Bacteria 1193
14 Ga0068852_100010263 3300005616 Bacteria 6987
15 Ga0068859_100380128 3300005617 Bacteria 1508
16 Ga0068851_10319398 3300005834 Bacteria 897
17 Ga0068862_100908108 3300005844 Archaea 866
18 Ga0097621_100027246 3300006237 Bacteria 4492
19 Ga0097621_100106036 3300006237 Bacteria 2370
20 Ga0068871_100030724 3300006358 Bacteria 4233
21 Ga0068865_101094038 3300006881 Bacteria 702
22 Ga0105240_10553205 3300009093 Bacteria 1273
23 Ga0114129_10626444 3300009147 Bacteria 1391
24 Ga0105241_11473255 3300009174 Bacteria 654
25 Ga0105248_10061223 3300009177 Bacteria 4226
26 Ga0105237_10611168 3300009545 Bacteria 1097
27 Ga0105238_12054292 3300009551 Bacteria 605
28 Ga0105239_10031021 3300010375 Bacteria 5880
29 Ga0157370_10002917 3300013104 Bacteria 20365
30 Ga0157374_10273321 3300013296 Bacteria 1666
31 Ga0163162_10046156 3300013306 Bacteria 4367
32 Ga0163162_10372496 3300013306 Bacteria 1561
33 Ga0163162_10816217 3300013306 Bacteria 1049
34 Ga0163163_10431808 3300014325 Bacteria 1376
35 Ga0157376_10068695 3300014969 Bacteria 3002
36 Ga0157376_10079819 3300014969 Bacteria 2806
37 Ga0157376_10362467 3300014969 Bacteria 1390
38 Ga0163161_10038385 3300017792 Bacteria 3435
39 Ga0207656_10214898 3300025321 Bacteria 933
40 Ga0207705_10458532 3300025909 Bacteria 989
41 Ga0207646_10187717 3300025922 Bacteria 1867
42 Ga0207694_10083699 3300025924 Bacteria 2509
43 Ga0207650_10588406 3300025925 Bacteria 935
44 Ga0207640_10004656 3300025981 Bacteria 7444
45 Ga0207639_10451144 3300026041 Bacteria 1167
46 Ga0207676_11245382 3300026095 Bacteria 738
47 Ga0207675_101938339 3300026118 Bacteria 607
48 Ga0207683_10491306 3300026121 Bacteria 1133
49 Ga0207698_10007310 3300026142 Bacteria 6921
50 Ga0265329_10155867 3300031242 Bacteria 741
51 Ga0265327_10005990 3300031251 Bacteria 9887
52 Ga0265316_10454873 3300031344 Bacteria 918
53 Ga0316576_10047894 3300031727 Bacteria 3098
54 Ga0316576_10059392 3300031727 Bacteria 2799
55 Ga0316576_10587109 3300031727 Bacteria 814
56 Ga0316588_1072097 3300033528 Unclassified 849
57 Ga0316588_1125972 3300033528 Unclassified 650
58 Ga0316588_1158502 3300033528 Bacteria 582
59 Ga0316587_1017349 3300033529 Bacteria 1206
60 Ga0316587_1089972 3300033529 Bacteria 585
61 Ga0373928_0002152 3300035084 Bacteria 3841
62 Ga0373951_0000962 3300035091 Bacteria 7748
63 Ga0316574_0058206 3300035398 Bacteria 2421
64 Ga0316574_0676877 3300035398 Bacteria 634
65 Ga0316584_0074445 3300036712 Bacteria 2546
66 Ga0316584_0183532 3300036712 Bacteria 1548
67 Ga0316584_0288153 3300036712 Bacteria 1192
68 Ga0400483_020045 3300039062 Bacteria 1612
69 Ga0451577_0000306 3300042876 Bacteria 94213
70 Ga0451577_0000426 3300042876 Bacteria 75695
71 Ga0451577_0030031 3300042876 Bacteria 4911
72 Ga0451577_0044865 3300042876 Bacteria 3956
73 Ga0451577_0053758 3300042876 Bacteria 3595
74 Ga0451577_0413918 3300042876 Bacteria 1224
75 Ga0451577_0807989 3300042876 Bacteria 847
76 Ga0451577_1337717 3300042876 Bacteria 636
77 Ga0453683_0022319 3300044673 Bacteria 4038
78 Ga0453683_0132309 3300044673 Bacteria 1572
79 Ga0453683_0771083 3300044673 Bacteria 632
80 Ga0453684_0000903 3300044712 Bacteria 99008
81 Ga0453684_0006396 3300044712 Bacteria 22426
82 Ga0453684_0011231 3300044712 Bacteria 15074
83 Ga0453684_0025657 3300044712 Bacteria 8550
84 Ga0453684_0028945 3300044712 Bacteria 7885
85 Ga0453684_0426412 3300044712 Bacteria 1480
86 Ga0453684_0598328 3300044712 Bacteria 1209
87 Ga0453684_0881749 3300044712 Bacteria 959
88 Ga0451576_0002315 3300045051 Bacteria 28849
89 Ga0451576_0011047 3300045051 Bacteria 10305
90 Ga0451576_0118166 3300045051 Bacteria 2760
91 Ga0451576_0136386 3300045051 Bacteria 2559
92 Ga0451576_0640781 3300045051 Bacteria 1116
93 Ga0451576_0863325 3300045051 Bacteria 950
94 Ga0451576_1000591 3300045051 Bacteria 876
95 Ga0495657_0108314 3300046675 Bacteria 1763
96 Ga0501032_0003577 3300049569 Bacteria 11851
97 Ga0501036_0469913 3300049572 Bacteria 1047
98 Ga0501037_0027940 3300049573 Bacteria 4169
99 Ga0501067_0006564 3300049583 Bacteria 6448
100 Ga0501068_0012257 3300049584 Bacteria 4851
101 Ga0501073_0000297 3300049589 Bacteria 32765
102 Ga0501076_0625824 3300049592 Unclassified 888
103 Ga0501077_0000039 3300049593 Bacteria 65680
104 Ga0501080_0002181 3300049742 Bacteria 17003
105 Ga0501081_0540911 3300049743 Bacteria 870
106 Ga0501044_0130738 3300049823 Bacteria 2504
107 Ga0501045_0655356 3300049824 Unclassified 776
108 nmdc:mga05p37_502548_c1 3300050507 Bacteria 1391
109 Ga0501082_1776156 3300060353 Bacteria 538

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035084 Ga0373928_0002152 Ga0373928_0002152_10_435 140
2 3300005340 Ga0070689_100286959 Ga0070689_1002869592 144
3 3300005844 Ga0068862_100908108 Ga0068862_1009081081 144
4 iso_pu_bacteria 2537561836 2538833041 149
5 iso_pu_bacteria 2643221562 2643830903 149
6 iso_pu_bacteria 2739367700 2739731942 149
7 iso_pu_bacteria 2895395659 2895396927 149
8 iso_pu_bacteria 2928963466 2928964638 149
9 3300026118 Ga0207675_101938339 Ga0207675_1019383391 150
10 iso_pu_bacteria 2558860983 2561466369 151
11 3300005330 Ga0070690_100777099 Ga0070690_1007770991 153
12 3300005455 Ga0070663_100187065 Ga0070663_1001870652 153
13 3300005563 Ga0068855_100595321 Ga0068855_1005953211 153
14 3300009545 Ga0105237_10611168 Ga0105237_106111682 153
15 3300009551 Ga0105238_12054292 Ga0105238_120542921 153
16 3300013104 Ga0157370_10002917 Ga0157370_100029178 153
17 3300014325 Ga0163163_10431808 Ga0163163_104318082 153
18 3300025924 Ga0207694_10083699 Ga0207694_100836991 153
19 3300025981 Ga0207640_10004656 Ga0207640_100046564 153
20 3300044673 Ga0453683_0771083 Ga0453683_0771083_23_487 153
21 3300045051 Ga0451576_0863325 Ga0451576_0863325_207_671 153
22 3300046675 Ga0495657_0108314 Ga0495657_0108314_339_803 153
23 3300005436 Ga0070713_100267384 Ga0070713_1002673843 154
24 3300006237 Ga0097621_100027246 Ga0097621_1000272464 154
25 3300013306 Ga0163162_10046156 Ga0163162_100461564 154
26 3300014969 Ga0157376_10362467 Ga0157376_103624671 154
27 3300033528 Ga0316588_1072097 Ga0316588_10720971 154
28 3300033528 Ga0316588_1125972 Ga0316588_11259721 154
29 3300033528 Ga0316588_1158502 Ga0316588_11585021 154
30 3300033529 Ga0316587_1017349 Ga0316587_10173491 154
31 3300033529 Ga0316587_1089972 Ga0316587_10899721 154
32 3300042876 Ga0451577_0000426 Ga0451577_0000426_64148_64615 154
33 3300044712 Ga0453684_0000903 Ga0453684_0000903_1777_2244 154
34 3300005330 Ga0070690_100267186 Ga0070690_1002671861 155
35 3300005331 Ga0070670_100344433 Ga0070670_1003444331 155
36 3300005456 Ga0070678_100619750 Ga0070678_1006197502 155
37 3300005539 Ga0068853_100423604 Ga0068853_1004236042 155
38 3300005616 Ga0068852_100010263 Ga0068852_1000102632 155
39 3300005834 Ga0068851_10319398 Ga0068851_103193982 155
40 3300006237 Ga0097621_100106036 Ga0097621_1001060362 155
41 3300006358 Ga0068871_100030724 Ga0068871_1000307244 155
42 3300006881 Ga0068865_101094038 Ga0068865_1010940381 155
43 3300009174 Ga0105241_11473255 Ga0105241_114732551 155
44 3300009177 Ga0105248_10061223 Ga0105248_100612233 155
45 3300010375 Ga0105239_10031021 Ga0105239_100310217 155
46 3300013296 Ga0157374_10273321 Ga0157374_102733212 155
47 3300013306 Ga0163162_10372496 Ga0163162_103724962 155
48 3300014969 Ga0157376_10068695 Ga0157376_100686954 155
49 3300014969 Ga0157376_10079819 Ga0157376_100798192 155
50 3300017792 Ga0163161_10038385 Ga0163161_100383853 155
51 3300025321 Ga0207656_10214898 Ga0207656_102148981 155
52 3300025925 Ga0207650_10588406 Ga0207650_105884062 155
53 3300026041 Ga0207639_10451144 Ga0207639_104511442 155
54 3300026095 Ga0207676_11245382 Ga0207676_112453821 155
55 3300026121 Ga0207683_10491306 Ga0207683_104913062 155
56 3300026142 Ga0207698_10007310 Ga0207698_100073109 155
57 3300031727 Ga0316576_10047894 Ga0316576_100478942 155
58 3300031727 Ga0316576_10059392 Ga0316576_100593923 155
59 3300035398 Ga0316574_0058206 Ga0316574_0058206_1226_1693 155
60 3300036712 Ga0316584_0183532 Ga0316584_0183532_664_1131 155
61 3300036712 Ga0316584_0288153 Ga0316584_0288153_518_985 155
62 3300042876 Ga0451577_0413918 Ga0451577_0413918_578_1048 155
63 3300044712 Ga0453684_0025657 Ga0453684_0025657_6307_6777 155
64 3300044712 Ga0453684_0881749 Ga0453684_0881749_339_809 155
65 3300045051 Ga0451576_0002315 Ga0451576_0002315_23526_23993 155
66 3300045051 Ga0451576_0011047 Ga0451576_0011047_4751_5218 155
67 3300045051 Ga0451576_0640781 Ga0451576_0640781_24_491 155
68 3300049743 Ga0501081_0540911 Ga0501081_0540911_182_652 155
69 3300005327 Ga0070658_10141951 Ga0070658_101419512 156
70 3300013306 Ga0163162_10816217 Ga0163162_108162172 156
71 3300025909 Ga0207705_10458532 Ga0207705_104585322 156
72 3300031344 Ga0265316_10454873 Ga0265316_104548731 156
73 3300035091 Ga0373951_0000962 Ga0373951_0000962_2335_2805 156
74 3300042876 Ga0451577_0030031 Ga0451577_0030031_1359_1829 156
75 3300042876 Ga0451577_0044865 Ga0451577_0044865_1625_2095 156
76 3300042876 Ga0451577_1337717 Ga0451577_1337717_69_539 156
77 3300044673 Ga0453683_0022319 Ga0453683_0022319_2328_2801 156
78 3300044673 Ga0453683_0132309 Ga0453683_0132309_374_844 156
79 3300044712 Ga0453684_0426412 Ga0453684_0426412_422_892 156
80 3300045051 Ga0451576_0118166 Ga0451576_0118166_1650_2120 156
81 3300049572 Ga0501036_0469913 Ga0501036_0469913_535_1032 156
82 3300005617 Ga0068859_100380128 Ga0068859_1003801281 157
83 3300009147 Ga0114129_10626444 Ga0114129_106264442 157
84 3300031242 Ga0265329_10155867 Ga0265329_101558671 157
85 3300031251 Ga0265327_10005990 Ga0265327_100059902 157
86 3300031727 Ga0316576_10587109 Ga0316576_105871092 157
87 3300039062 Ga0400483_020045 Ga0400483_020045_365_838 157
88 3300042876 Ga0451577_0000306 Ga0451577_0000306_22625_23116 157
89 3300042876 Ga0451577_0807989 Ga0451577_0807989_83_556 157
90 3300044712 Ga0453684_0011231 Ga0453684_0011231_6299_6790 157
91 3300044712 Ga0453684_0028945 Ga0453684_0028945_6880_7353 157
92 3300045051 Ga0451576_1000591 Ga0451576_1000591_206_679 157
93 3300049569 Ga0501032_0003577 Ga0501032_0003577_10171_10644 157
94 3300049573 Ga0501037_0027940 Ga0501037_0027940_2509_2982 157
95 3300049583 Ga0501067_0006564 Ga0501067_0006564_1317_1790 157
96 3300049584 Ga0501068_0012257 Ga0501068_0012257_1141_1614 157
97 3300049589 Ga0501073_0000297 Ga0501073_0000297_19832_20305 157
98 3300049592 Ga0501076_0625824 Ga0501076_0625824_326_799 157
99 3300049593 Ga0501077_0000039 Ga0501077_0000039_683_1156 157
100 3300049742 Ga0501080_0002181 Ga0501080_0002181_14028_14501 157
101 3300049823 Ga0501044_0130738 Ga0501044_0130738_532_1005 157
102 3300049824 Ga0501045_0655356 Ga0501045_0655356_190_663 157
103 3300060353 Ga0501082_1776156 Ga0501082_1776156_17_490 157
104 3300005468 Ga0070707_100221372 Ga0070707_1002213724 158
105 3300005518 Ga0070699_100407361 Ga0070699_1004073612 158
106 3300009093 Ga0105240_10553205 Ga0105240_105532052 158
107 3300025922 Ga0207646_10187717 Ga0207646_101877174 158
108 3300035398 Ga0316574_0676877 Ga0316574_0676877_105_581 158
109 3300036712 Ga0316584_0074445 Ga0316584_0074445_1817_2293 158
110 3300042876 Ga0451577_0053758 Ga0451577_0053758_935_1417 158
111 3300044712 Ga0453684_0006396 Ga0453684_0006396_18740_19222 158
112 3300044712 Ga0453684_0598328 Ga0453684_0598328_508_996 158
113 3300045051 Ga0451576_0136386 Ga0451576_0136386_1668_2150 158
114 3300050507 nmdc:mga05p37_502548_c1 nmdc:mga05p37_502548_c1_234_806 158
115 3300004799 Ga0058863_11517007 Ga0058863_115170071 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

4

133

0.99

PF08534

Redoxin

Redoxin

3

147

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9538 14 158
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.938 3 156
5imf-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - structure f5 0.9327 7 158
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9318 3 158
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9262 3 156
ID Description Score Start End Superfamily
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9769 5 156 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9699 6 154 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9604 7 155 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9582 5 156 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9572 6 154 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V2DAP0-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9902 5 156 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A1Y5N691-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9889 5 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A7T9G259-F1-model_v4 deleted 0.9887 3 156
AF-A0A128EBZ7-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9885 7 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A0S4S0M6-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9877 6 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Feature Viewer

pLDDT pTM Quality
93.44 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map