F080506

General Info

Members Datasets Scaffolds Average Seq Length
114 83 106 104

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0032105|Ga0496115_0032105_2031_2405
Length 124
Sequence MALFTIGSKAVFKTFLIMIHLFKTNVGRLRIIAFLEGLSLLVLIFVAVPLKHFVNDPSVVKTMGPIHGALFLLFVFNALSVGVEQQWKFKETTWKVLLACLIPFGTFYIDHKILAKIPTASNEH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
3 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
4 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
5 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
6 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
7 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
8 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
9 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
32 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
33 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
40 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
41 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
42 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
43 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
44 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
45 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
46 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
47 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
48 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
49 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
50 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
51 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
52 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
53 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
54 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
55 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
56 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
57 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
58 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
59 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
60 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
61 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
62 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
65 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
66 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
67 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
68 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
69 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
70 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
71 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
72 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
73 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
74 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
75 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
76 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
77 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
78 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
79 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
80 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
81 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
82 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
83 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.98
Metatranscriptomes 0
Isolates 7.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.68
Nodule 0
Rhizoplane 2.63
Rhizosphere 45.61
Stem 0
Stem Tuber 0
Unclassified 28.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3860585 2162886007 Unclassified 932
2 JGI25162J39368_1000301 3300002737 Bacteria 45433
3 rootH1_10071059 3300003316 Bacteria 4550
4 rootH2_10107991 3300003320 Bacteria 3547
5 rootH2_10145847 3300003320 Unclassified 1370
6 rootH2_10278925 3300003320 Bacteria 2667
7 rootH2_10284341 3300003320 Unclassified 1594
8 rootL2_10016026 3300003322 Bacteria 9708
9 rootL2_10141642 3300003322 Unclassified 2243
10 rootL2_10249239 3300003322 Bacteria 1316
11 rootL2_10289580 3300003322 Bacteria 2455
12 rootH1_10052920 3300003323 Bacteria 18808
13 rootH1_10108072 3300003323 Unclassified 1349
14 rootH1_10213823 3300003323 Bacteria 2638
15 rootH1_10238186 3300003323 Bacteria 2785
16 rootH1_10247839 3300003323 Bacteria 4490
17 Ga0055531_10000104 3300003794 Bacteria 92278
18 Ga0065704_10070542 3300005289 Bacteria 21184
19 Ga0065704_10078261 3300005289 Unclassified 4480
20 Ga0065704_10136389 3300005289 Bacteria 1566
21 Ga0070667_101536621 3300005367 Bacteria 625
22 Ga0068853_100541547 3300005539 Bacteria 1102
23 Ga0068855_100139124 3300005563 Bacteria 2769
24 Ga0105250_10235898 3300009092 Bacteria 779
25 Ga0105240_10000020 3300009093 Bacteria 399699
26 Ga0105240_10173162 3300009093 Bacteria 2554
27 Ga0105237_10000232 3300009545 Bacteria 79362
28 Ga0105239_10002611 3300010375 Bacteria 22800
29 Ga0105239_10142345 3300010375 Bacteria 2673
30 Ga0157373_11084102 3300013100 Bacteria 600
31 Ga0157371_10004771 3300013102 Bacteria 11688
32 Ga0157371_10758775 3300013102 Unclassified 729
33 Ga0157370_10000841 3300013104 Bacteria 38964
34 Ga0157370_10013508 3300013104 Bacteria 8407
35 Ga0157369_10000766 3300013105 Bacteria 41505
36 Ga0163162_10059656 3300013306 Bacteria 3848
37 Ga0182006_1046906 3300015261 Bacteria 1677
38 Ga0182006_1062579 3300015261 Bacteria 1400
39 Ga0163161_10000119 3300017792 Bacteria 74760
40 Ga0209437_100030 3300025233 Bacteria 532466
41 Ga0209129_1017455 3300025258 Bacteria 1407
42 Ga0209257_1000013 3300025304 Bacteria 1047305
43 Ga0207696_1202484 3300025711 Bacteria 521
44 Ga0207695_10000020 3300025913 Bacteria 723025
45 Ga0207695_10061199 3300025913 Bacteria 3892
46 Ga0207671_10000259 3300025914 Bacteria 79366
47 Ga0207667_10242583 3300025949 Bacteria 1844
48 Ga0207658_12156383 3300025986 Bacteria 506
49 Ga0316176_1072368 3300030732 Bacteria 13938
50 Ga0265327_10013138 3300031251 Bacteria 5519
51 Ga0307408_100001598 3300031548 Bacteria 16745
52 Ga0307405_10000001 3300031731 Bacteria 1731270
53 Ga0307406_10000086 3300031901 Bacteria 52871
54 Ga0307406_10009879 3300031901 Bacteria 5370
55 Ga0307414_10836587 3300032004 Unclassified 841
56 Ga0439431_0001088 3300041997 Bacteria 5886
57 Ga0439445_0112963 3300042004 Bacteria 776
58 Ga0439435_0301987 3300042436 Bacteria 548
59 Ga0495638_0331973 3300046460 Bacteria 809
60 Ga0495650_0115292 3300046471 Bacteria 993
61 Ga0495606_0020025 3300046507 Bacteria 4950
62 Ga0495625_0016796 3300046660 Bacteria 5747
63 Ga0496102_1715402 3300048905 Bacteria 546
64 Ga0496115_0032105 3300048918 Bacteria 4142
65 Ga0496115_0108787 3300048918 Bacteria 2276
66 Ga0496116_0000041 3300048919 Bacteria 343299
67 Ga0496117_0002687 3300048920 Bacteria 21966
68 Ga0496117_0142880 3300048920 Bacteria 1430
69 Ga0496118_0073996 3300048921 Bacteria 2437
70 Ga0496121_0013970 3300048924 Bacteria 8577
71 Ga0496122_0258436 3300048925 Bacteria 968
72 Ga0496124_0090718 3300048927 Bacteria 2492
73 Ga0496124_0215302 3300048927 Bacteria 1450
74 Ga0496124_0498317 3300048927 Bacteria 817
75 Ga0496125_0000026 3300048928 Bacteria 397380
76 Ga0496125_0001214 3300048928 Bacteria 38715
77 Ga0496126_0020005 3300048929 Bacteria 6575
78 Ga0496126_0031992 3300048929 Bacteria 4962
79 Ga0501034_1131621 3300049571 Unclassified 663
80 Ga0501043_0399628 3300049579 Bacteria 1038
81 Ga0501217_010797 3300049661 Bacteria 2009
82 Ga0501238_001711 3300049671 Bacteria 2558
83 Ga0501238_080463 3300049671 Bacteria 513
84 Ga0501241_004897 3300049758 Bacteria 2499
85 Ga0500578_0000324 3300053086 Bacteria 58297
86 Ga0500644_0004874 3300053088 Bacteria 3374
87 Ga0500646_0127418 3300053090 Bacteria 824
88 Ga0500646_0167598 3300053090 Bacteria 737
89 Ga0500646_0270864 3300053090 Bacteria 602
90 Ga0500641_0000006 3300053096 Bacteria 223991
91 Ga0500660_234646 3300053100 Unclassified 585
92 Ga0500569_007310 3300053109 Bacteria 2471
93 Ga0500618_018787 3300053125 Bacteria 1707
94 Ga0500652_271447 3300053131 Unclassified 665
95 Ga0500655_044898 3300053133 Unclassified 872
96 Ga0500658_0017072 3300053134 Unclassified 2708
97 Ga0500559_0047413 3300053136 Bacteria 1887
98 Ga0500577_0018349 3300053142 Bacteria 2247
99 Ga0500589_172658 3300053147 Bacteria 857
100 Ga0500616_0007874 3300053153 Bacteria 6700
101 Ga0500616_0049958 3300053153 Unclassified 2210
102 Ga0500616_0208232 3300053153 Bacteria 861
103 Ga0500622_0000026 3300053156 Bacteria 235660
104 Ga0500622_0000267 3300053156 Bacteria 53425
105 Ga0500627_0154560 3300053158 Bacteria 1036
106 Ga0500656_006391 3300053732 Bacteria 1195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10145847 rootH2_101458472 99
2 3300003322 rootL2_10289580 rootL2_102895802 99
3 3300003323 rootH1_10052920 rootH1_1005292015 99
4 3300003323 rootH1_10238186 rootH1_102381862 99
5 3300003320 rootH2_10107991 rootH2_101079916 100
6 3300003320 rootH2_10278925 rootH2_102789252 100
7 3300003323 rootH1_10213823 rootH1_102138231 100
8 3300003323 rootH1_10247839 rootH1_102478394 100
9 3300005289 Ga0065704_10070542 Ga0065704_100705425 100
10 3300015261 Ga0182006_1062579 Ga0182006_10625792 100
11 3300031731 Ga0307405_10000001 Ga0307405_100000011160 100
12 3300031901 Ga0307406_10009879 Ga0307406_100098795 100
13 3300048918 Ga0496115_0108787 Ga0496115_0108787_1445_1747 100
14 iso_pu_bacteria 2852623160 2852625429 100
15 iso_pu_bacteria 2896344016 2896344767 100
16 iso_pu_bacteria 2904555929 2904559405 100
17 3300003322 rootL2_10249239 rootL2_102492393 101
18 3300003794 Ga0055531_10000104 Ga0055531_1000010479 101
19 3300013100 Ga0157373_11084102 Ga0157373_110841022 101
20 3300025304 Ga0209257_1000013 Ga0209257_1000013173 101
21 3300048905 Ga0496102_1715402 Ga0496102_1715402_122_478 101
22 3300048929 Ga0496126_0020005 Ga0496126_0020005_691_1047 101
23 3300053086 Ga0500578_0000324 Ga0500578_0000324_9625_9930 101
24 iso_pu_bacteria 2857613821 2857617255 101
25 iso_pu_bacteria 2929154850 2929157231 101
26 3300002737 JGI25162J39368_1000301 JGI25162J39368_100030116 102
27 3300003322 rootL2_10141642 rootL2_101416422 102
28 3300003323 rootH1_10108072 rootH1_101080722 102
29 3300005289 Ga0065704_10136389 Ga0065704_101363892 102
30 3300005367 Ga0070667_101536621 Ga0070667_1015366212 102
31 3300010375 Ga0105239_10002611 Ga0105239_100026116 102
32 3300013102 Ga0157371_10758775 Ga0157371_107587752 102
33 3300025233 Ga0209437_100030 Ga0209437_100030399 102
34 3300025258 Ga0209129_1017455 Ga0209129_10174553 102
35 3300025986 Ga0207658_12156383 Ga0207658_121563831 102
36 3300046507 Ga0495606_0020025 Ga0495606_0020025_2770_3078 102
37 3300053088 Ga0500644_0004874 Ga0500644_0004874_124_432 102
38 3300053090 Ga0500646_0167598 Ga0500646_0167598_41_349 102
39 3300053090 Ga0500646_0270864 Ga0500646_0270864_77_385 102
40 3300053096 Ga0500641_0000006 Ga0500641_0000006_59778_60086 102
41 3300053109 Ga0500569_007310 Ga0500569_007310_1138_1446 102
42 3300053131 Ga0500652_271447 Ga0500652_271447_234_542 102
43 3300053134 Ga0500658_0017072 Ga0500658_0017072_1524_1832 102
44 3300053142 Ga0500577_0018349 Ga0500577_0018349_936_1244 102
45 3300053147 Ga0500589_172658 Ga0500589_172658_148_507 102
46 3300053153 Ga0500616_0007874 Ga0500616_0007874_6121_6429 102
47 3300053153 Ga0500616_0049958 Ga0500616_0049958_936_1244 102
48 3300053153 Ga0500616_0208232 Ga0500616_0208232_305_613 102
49 3300053156 Ga0500622_0000267 Ga0500622_0000267_15004_15312 102
50 3300053732 Ga0500656_006391 Ga0500656_006391_728_1036 102
51 iso_pu_bacteria 2738541279 2738736460 102
52 iso_pu_bacteria 2738541285 2738768903 102
53 iso_pu_bacteria 2738543007 2739218042 102
54 3300003316 rootH1_10071059 rootH1_100710593 103
55 3300003322 rootL2_10016026 rootL2_100160265 103
56 3300009092 Ga0105250_10235898 Ga0105250_102358982 103
57 3300013102 Ga0157371_10004771 Ga0157371_100047712 103
58 3300013104 Ga0157370_10000841 Ga0157370_1000084139 103
59 3300013104 Ga0157370_10013508 Ga0157370_100135082 103
60 3300013105 Ga0157369_10000766 Ga0157369_1000076621 103
61 3300015261 Ga0182006_1046906 Ga0182006_10469063 103
62 3300025711 Ga0207696_1202484 Ga0207696_12024842 103
63 3300048919 Ga0496116_0000041 Ga0496116_0000041_154966_155277 103
64 3300048920 Ga0496117_0142880 Ga0496117_0142880_504_815 103
65 3300048921 Ga0496118_0073996 Ga0496118_0073996_1521_1832 103
66 3300048924 Ga0496121_0013970 Ga0496121_0013970_3566_3877 103
67 3300048927 Ga0496124_0215302 Ga0496124_0215302_64_375 103
68 3300048927 Ga0496124_0498317 Ga0496124_0498317_90_401 103
69 3300048928 Ga0496125_0000026 Ga0496125_0000026_312038_312349 103
70 3300048929 Ga0496126_0031992 Ga0496126_0031992_3031_3342 103
71 3300049661 Ga0501217_010797 Ga0501217_010797_678_989 103
72 3300053156 Ga0500622_0000026 Ga0500622_0000026_25914_26225 103
73 3300053158 Ga0500627_0154560 Ga0500627_0154560_588_899 103
74 3300005289 Ga0065704_10078261 Ga0065704_100782613 104
75 3300009093 Ga0105240_10000020 Ga0105240_10000020179 104
76 3300025913 Ga0207695_10000020 Ga0207695_10000020347 104
77 3300046460 Ga0495638_0331973 Ga0495638_0331973_438_752 104
78 3300046660 Ga0495625_0016796 Ga0495625_0016796_2478_2792 104
79 3300048920 Ga0496117_0002687 Ga0496117_0002687_18629_18946 104
80 3300048925 Ga0496122_0258436 Ga0496122_0258436_556_873 104
81 3300048927 Ga0496124_0090718 Ga0496124_0090718_760_1077 104
82 3300053133 Ga0500655_044898 Ga0500655_044898_400_714 104
83 3300053136 Ga0500559_0047413 Ga0500559_0047413_76_390 104
84 3300031548 Ga0307408_100001598 Ga0307408_10000159811 105
85 3300031901 Ga0307406_10000086 Ga0307406_1000008612 105
86 3300032004 Ga0307414_10836587 Ga0307414_108365871 105
87 3300041997 Ga0439431_0001088 Ga0439431_0001088_701_1018 105
88 3300042004 Ga0439445_0112963 Ga0439445_0112963_188_505 105
89 3300049571 Ga0501034_1131621 Ga0501034_1131621_77_394 105
90 3300049579 Ga0501043_0399628 Ga0501043_0399628_98_415 105
91 3300049671 Ga0501238_001711 Ga0501238_001711_1931_2248 105
92 3300005539 Ga0068853_100541547 Ga0068853_1005415471 106
93 3300005563 Ga0068855_100139124 Ga0068855_1001391246 106
94 3300009093 Ga0105240_10173162 Ga0105240_101731622 106
95 3300009545 Ga0105237_10000232 Ga0105237_100002325 106
96 3300010375 Ga0105239_10142345 Ga0105239_101423451 106
97 3300013306 Ga0163162_10059656 Ga0163162_100596565 106
98 3300017792 Ga0163161_10000119 Ga0163161_1000011962 106
99 3300025913 Ga0207695_10061199 Ga0207695_100611996 106
100 3300025914 Ga0207671_10000259 Ga0207671_1000025956 106
101 3300025949 Ga0207667_10242583 Ga0207667_102425833 106
102 3300031251 Ga0265327_10013138 Ga0265327_100131383 106
103 3300042436 Ga0439435_0301987 Ga0439435_0301987_200_520 106
104 3300049671 Ga0501238_080463 Ga0501238_080463_156_476 106
105 3300053090 Ga0500646_0127418 Ga0500646_0127418_125_445 106
106 3300053125 Ga0500618_018787 Ga0500618_018787_266_586 106
107 3300048918 Ga0496115_0032105 Ga0496115_0032105_2031_2405 107
108 3300048928 Ga0496125_0001214 Ga0496125_0001214_6480_6803 107
109 3300030732 Ga0316176_1072368 Ga0316176_10723688 110
110 3300053100 Ga0500660_234646 Ga0500660_234646_70_402 110
111 3300046471 Ga0495650_0115292 Ga0495650_0115292_443_778 111
112 2162886007 SwRhRL2b_contig_3860585 SwRhRL2b_0752.00006030 112
113 3300003320 rootH2_10284341 rootH2_102843412 112
114 3300049758 Ga0501241_004897 Ga0501241_004897_1144_1485 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12823

DUF3817

Domain of unknown function (DUF3817)

26

115

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a8p-assembly3.cif.gz_C crystal structure of the tiam2 phccex domain 0.7035 3 84
5och-assembly2.cif.gz_C the crystal structure of human abcb8 in an outward-facing state 0.677 2 65
8gn2-assembly1.cif.gz_Z crystal structure of ppbq-bound photosystem ii complex 0.6364 1 70
8gn2-assembly1.cif.gz_Z crystal structure of ppbq-bound photosystem ii complex 0.6083 1 70
8div-assembly1.cif.gz_A crystal structure of navab i22v as a basis for the human nav1.7 inherited erythromelalgia i136v mutation 0.4225 5 101
ID Description Score Start End Superfamily
af_Q7JZE1_1_232_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.6307 3 83 1.20.1420.10
3wu2z00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Photosystem II PsbZ, reaction centre 0.6148 1 71 1.10.287.740
af_K7KM93_6_135_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6127 12 91 1.20.140.150
3wu2z00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Photosystem II PsbZ, reaction centre 0.6071 1 71 1.10.287.740
af_O01795_1037_1183_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.607 7 75 1.20.950.20
ID Description Score Start End GO Terms
AF-A0A2P2E3N1-F1-model_v4 DUF3817 domain-containing protein 0.9626 8 97 GO:0005886
AF-A0A7X1AVV8-F1-model_v4 DUF3817 domain-containing protein 0.9583 12 91 GO:0005886
AF-A0A7Y2XPU3-F1-model_v4 DUF3817 domain-containing protein 0.9569 7 94 GO:0005886
AF-A0A4Q5QQF0-F1-model_v4 DUF3817 domain-containing protein 0.9555 1 86 GO:0005886
AF-A0A3R8IRV9-F1-model_v4 DUF3817 domain-containing protein 0.9537 5 96 GO:0005886

Feature Viewer

pLDDT pTM Quality
76.7 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map