F079325

General Info

Members Datasets Scaffolds Average Seq Length
114 80 228 496

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10027797|Ga0265338_100277974
Length 528
Sequence MTDLLPAAAGGKASSIPLMGRDPEPTLFELSQPDRRSWQLRTTGVPEWSVDDLVPAGHRREHPVPLAEVSERDLVGHFTRLSHRQFSVDLGAYPLGSCTMKYNPKVCDAVAALPGLAGVHPATPAPFTQGWLALLVELEQALCQITGMAAATLQPAAGAAGELTGLLLMRAYHAAQEGAAQGQERNRIVIPDSAHGTNPASVTLGGYQVTTVPSDHRGCVDMDALRGVLDTDVAGIMLTNPNTLGLFEEDIREIAAAVHEVGGLLYYDGANLNAILGVVRPGDMGFDIVHMNLHKTFATPHGGGGPGAGPVAVSPRLVDFLPGPRPVRLGGEMGGGEDGEXGRDGGSYGWATPPRSIGRIHSWHGNALVLARALTYILVHGGDGLRRVAERAVLNANWLRVRLADTFDVPFDRPCMHEVVLAASSLKKAHGVRALDVAKGLLEEGFHSPTVYFPLIVDEALMLEPTETESLQTLEALAASLDKIVAEAQGVADGAVAPATEAPRTTPVRRVDEARAARNLVPTFGARG

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
48 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
55 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
58 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
67 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
68 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
75 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
76 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
77 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
78 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
79 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
80 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.63
Nodule 0
Rhizoplane 0
Rhizosphere 94.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10027797 3300028800 Bacteria 5663
2 Ga0065715_10005230 3300005293 Bacteria 5751
3 Ga0070670_100026818 3300005331 Bacteria 4956
4 Ga0070689_100018075 3300005340 Bacteria 5187
5 Ga0070688_100004455 3300005365 Bacteria 7293
6 Ga0070703_10000347 3300005406 Bacteria 20275
7 Ga0070714_100018041 3300005435 Bacteria 5725
8 Ga0070713_100132914 3300005436 Bacteria 2196
9 Ga0070705_100012061 3300005440 Bacteria 4380
10 Ga0070708_100002358 3300005445 Bacteria 14622
11 Ga0070708_100011628 3300005445 Bacteria 7164
12 Ga0070708_100034244 3300005445 Bacteria 4417
13 Ga0070681_10033821 3300005458 Bacteria 5132
14 Ga0068867_100084906 3300005459 Bacteria 2393
15 Ga0070706_100002864 3300005467 Bacteria 17194
16 Ga0070706_100004806 3300005467 Bacteria 12944
17 Ga0070706_100005870 3300005467 Bacteria 11641
18 Ga0070706_100061005 3300005467 Bacteria 3481
19 Ga0070707_100019664 3300005468 Bacteria 6365
20 Ga0070707_100204930 3300005468 Bacteria 1922
21 Ga0070707_100250027 3300005468 Bacteria 1725
22 Ga0070698_100000121 3300005471 Bacteria 67418
23 Ga0070698_100002666 3300005471 Bacteria 19690
24 Ga0070698_100050833 3300005471 Bacteria 4223
25 Ga0070698_100111033 3300005471 Bacteria 2706
26 Ga0070699_100079510 3300005518 Bacteria 2856
27 Ga0070697_100041384 3300005536 Bacteria 3729
28 Ga0070697_100046089 3300005536 Bacteria 3533
29 Ga0070697_100071467 3300005536 Bacteria 2846
30 Ga0070695_100016353 3300005545 Bacteria 4489
31 Ga0070704_100004901 3300005549 Bacteria 7768
32 Ga0068857_100009176 3300005577 Bacteria 8587
33 Ga0068863_100225370 3300005841 Bacteria 1807
34 Ga0068860_100057270 3300005843 Bacteria 3705
35 Ga0081455_10005265 3300005937 Bacteria 14209
36 Ga0081538_10004052 3300005981 Bacteria 13630
37 Ga0081538_10013100 3300005981 Bacteria 6590
38 Ga0075363_100049955 3300006048 Bacteria 2228
39 Ga0075428_100000163 3300006844 Bacteria 61053
40 Ga0075428_100012063 3300006844 Bacteria 9613
41 Ga0075428_100114292 3300006844 Bacteria 2941
42 Ga0075430_100037078 3300006846 Bacteria 4133
43 Ga0075431_100022429 3300006847 Bacteria 6453
44 Ga0075433_10062948 3300006852 Bacteria 3250
45 Ga0075434_100001586 3300006871 Bacteria 19264
46 Ga0099794_10000768 3300007265 Bacteria 10808
47 Ga0111539_10009830 3300009094 Bacteria 12072
48 Ga0105245_10000822 3300009098 Bacteria 28307
49 Ga0114129_10002903 3300009147 Bacteria 23978
50 Ga0114129_10010126 3300009147 Bacteria 13439
51 Ga0114129_10060308 3300009147 Bacteria 5304
52 Ga0157377_10067738 3300014745 Bacteria 2056
53 Ga0213876_10056564 3300021384 Bacteria 2071
54 Ga0207653_10000135 3300025885 Bacteria 52625
55 Ga0207684_10000108 3300025910 Bacteria 156641
56 Ga0207684_10011675 3300025910 Bacteria 7667
57 Ga0207684_10020291 3300025910 Bacteria 5676
58 Ga0207684_10102209 3300025910 Bacteria 2450
59 Ga0207707_10053278 3300025912 Bacteria 3522
60 Ga0207707_10088677 3300025912 Bacteria 2703
61 Ga0207646_10000023 3300025922 Bacteria 255171
62 Ga0207646_10003988 3300025922 Bacteria 16355
63 Ga0207650_10017695 3300025925 Bacteria 4993
64 Ga0207664_10052684 3300025929 Bacteria 3219
65 Ga0207667_10190329 3300025949 Bacteria 2105
66 Ga0207640_10061164 3300025981 Bacteria 2493
67 Ga0207640_10133318 3300025981 Bacteria 1799
68 Ga0207428_10013556 3300027907 Bacteria 7114
69 Ga0268264_10102378 3300028381 Bacteria 2492
70 Ga0265330_10000483 3300031235 Bacteria 26688
71 Ga0265332_10001137 3300031238 Bacteria 15425
72 Ga0265332_10005455 3300031238 Bacteria 5864
73 Ga0265320_10057362 3300031240 Bacteria 1868
74 Ga0265325_10024268 3300031241 Bacteria 3301
75 Ga0265329_10014949 3300031242 Bacteria 2725
76 Ga0265327_10000171 3300031251 Bacteria 139992
77 Ga0265327_10015870 3300031251 Bacteria 4827
78 Ga0265316_10000057 3300031344 Bacteria 119213
79 Ga0265314_10000039 3300031711 Bacteria 220957
80 Ga0265314_10021578 3300031711 Bacteria 4947
81 Ga0265342_10005833 3300031712 Bacteria 9299
82 Ga0316576_10034803 3300031727 Bacteria 3592
83 Ga0316578_10075169 3300031728 Bacteria 2004
84 Ga0316577_10011214 3300031733 Bacteria 4854
85 Ga0307413_10025491 3300031824 Bacteria 3242
86 Ga0307407_10014315 3300031903 Bacteria 3880
87 Ga0307409_100019372 3300031995 Bacteria 4605
88 Ga0307416_100010051 3300032002 Bacteria 6232
89 Ga0373955_0075369 3300035172 Bacteria 1896
90 Ga0436364_0372392 3300037853 Bacteria 3211
91 Ga0436365_0619068 3300039437 Bacteria 3742
92 Ga0436360_0836227 3300039438 Bacteria 3469
93 Ga0436362_0391670 3300039453 Bacteria 2960
94 Ga0436362_0703893 3300039453 Bacteria 2312
95 Ga0453683_0011790 3300044673 Bacteria 5756
96 Ga0466966_0118691 3300044684 Bacteria 1626
97 Ga0453684_0011897 3300044712 Bacteria 14490
98 Ga0453684_0079612 3300044712 Bacteria 4096
99 Ga0466960_0029812 3300044901 Bacteria 2507
100 Ga0451576_0000578 3300045051 Bacteria 78024
101 Ga0451576_0000912 3300045051 Bacteria 55998
102 Ga0451576_0080901 3300045051 Bacteria 3379
103 Ga0451576_0114088 3300045051 Bacteria 2812
104 Ga0495628_0070888 3300046516 Bacteria 2717
105 Ga0495676_0113364 3300047321 Bacteria 1985
106 nmdc:mga05p37_2155_c1 3300050507 Bacteria 22951
107 nmdc:mga05p37_69214_c1 3300050507 Bacteria 4341
108 nmdc:mga05p37_83314_c1 3300050507 Bacteria 3940
109 nmdc:mga08y16_2560_c1 3300050511 Bacteria 18701
110 nmdc:mga0n895_18025_c1 3300050512 Bacteria 6526
111 nmdc:mga0a205_153425_c1 3300050515 Bacteria 2202
112 nmdc:mga0a205_42004_c1 3300050515 Bacteria 4406
113 Ga0500568_0000069 3300053139 Bacteria 99921
114 Ga0500616_0030278 3300053153 Bacteria 2973
115 Ga0265338_10027797
116 Ga0065715_10005230
117 Ga0070670_100026818
118 Ga0070689_100018075
119 Ga0070688_100004455
120 Ga0070703_10000347
121 Ga0070714_100018041
122 Ga0070713_100132914
123 Ga0070705_100012061
124 Ga0070708_100002358
125 Ga0070708_100011628
126 Ga0070708_100034244
127 Ga0070681_10033821
128 Ga0068867_100084906
129 Ga0070706_100002864
130 Ga0070706_100004806
131 Ga0070706_100005870
132 Ga0070706_100061005
133 Ga0070707_100019664
134 Ga0070707_100204930
135 Ga0070707_100250027
136 Ga0070698_100000121
137 Ga0070698_100002666
138 Ga0070698_100050833
139 Ga0070698_100111033
140 Ga0070699_100079510
141 Ga0070697_100041384
142 Ga0070697_100046089
143 Ga0070697_100071467
144 Ga0070695_100016353
145 Ga0070704_100004901
146 Ga0068857_100009176
147 Ga0068863_100225370
148 Ga0068860_100057270
149 Ga0081455_10005265
150 Ga0081538_10004052
151 Ga0081538_10013100
152 Ga0075363_100049955
153 Ga0075428_100000163
154 Ga0075428_100012063
155 Ga0075428_100114292
156 Ga0075430_100037078
157 Ga0075431_100022429
158 Ga0075433_10062948
159 Ga0075434_100001586
160 Ga0099794_10000768
161 Ga0111539_10009830
162 Ga0105245_10000822
163 Ga0114129_10002903
164 Ga0114129_10010126
165 Ga0114129_10060308
166 Ga0157377_10067738
167 Ga0213876_10056564
168 Ga0207653_10000135
169 Ga0207684_10000108
170 Ga0207684_10011675
171 Ga0207684_10020291
172 Ga0207684_10102209
173 Ga0207707_10053278
174 Ga0207707_10088677
175 Ga0207646_10000023
176 Ga0207646_10003988
177 Ga0207650_10017695
178 Ga0207664_10052684
179 Ga0207667_10190329
180 Ga0207640_10061164
181 Ga0207640_10133318
182 Ga0207428_10013556
183 Ga0268264_10102378
184 Ga0265330_10000483
185 Ga0265332_10001137
186 Ga0265332_10005455
187 Ga0265320_10057362
188 Ga0265325_10024268
189 Ga0265329_10014949
190 Ga0265327_10000171
191 Ga0265327_10015870
192 Ga0265316_10000057
193 Ga0265314_10000039
194 Ga0265314_10021578
195 Ga0265342_10005833
196 Ga0316576_10034803
197 Ga0316578_10075169
198 Ga0316577_10011214
199 Ga0307413_10025491
200 Ga0307407_10014315
201 Ga0307409_100019372
202 Ga0307416_100010051
203 Ga0373955_0075369
204 Ga0436364_0372392
205 Ga0436365_0619068
206 Ga0436360_0836227
207 Ga0436362_0391670
208 Ga0436362_0703893
209 Ga0453683_0011790
210 Ga0466966_0118691
211 Ga0453684_0011897
212 Ga0453684_0079612
213 Ga0466960_0029812
214 Ga0451576_0000578
215 Ga0451576_0000912
216 Ga0451576_0080901
217 Ga0451576_0114088
218 Ga0495628_0070888
219 Ga0495676_0113364
220 nmdc:mga05p37_2155_c1
221 nmdc:mga05p37_69214_c1
222 nmdc:mga05p37_83314_c1
223 nmdc:mga08y16_2560_c1
224 nmdc:mga0n895_18025_c1
225 nmdc:mga0a205_153425_c1
226 nmdc:mga0a205_42004_c1
227 Ga0500568_0000069
228 Ga0500616_0030278

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21478

GcvP2_C

Glycine dehydrogenase, C-terminal domain

388

508

0.93

PF00266

Aminotran_5

Aminotransferase class-V

170

335

0.76

PF02347

GDC-P

Glycine cleavage system P-protein

39

337

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lgl-assembly1.cif.gz_B crystal structure of glycine decarboxylase p-protein from synechocystis sp. pcc 6803, apo form 0.8526 61 472
6i34-assembly2.cif.gz_D crystal structure of neanderthal glycine decarboxylase (p-protein) 0.8506 61 472
6i33-assembly1.cif.gz_B crystal structure of human glycine decarboxylase (p-protein) 0.8466 61 470
4lhd-assembly1.cif.gz_B crystal structure of synechocystis sp. pcc 6803 glycine decarboxylase (p-protein), holo form with pyridoxal-5'-phosphate and glycine, closed flexible loop 0.8465 61 472
6i34-assembly2.cif.gz_C crystal structure of neanderthal glycine decarboxylase (p-protein) 0.8399 61 472
ID Description Score Start End Superfamily
af_Q2FY35_346_448_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9754 364 457 3.90.1150.10
af_K7TIN2_588_818_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9647 105 309 3.40.640.10
1wyvH03 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9642 93 366 3.40.640.10
1wyvH03 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9502 93 366 3.40.640.10
af_Q54KM7_558_805_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9115 105 358 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A354FBL3-F1-model_v4 Aminomethyl-transferring glycine dehydrogenase subunit GcvPB (EC 1.4.4.2) 0.9917 119 269 GO:0004375
GO:0005829
GO:0005960
GO:0016594
GO:0019464
GO:0030170
AF-A0A538E810-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9853 158 266 GO:0004375
GO:0005829
GO:0005960
GO:0008483
GO:0016594
GO:0019464
GO:0030170
AF-A0A354FBL3-F1-model_v4 Aminomethyl-transferring glycine dehydrogenase subunit GcvPB (EC 1.4.4.2) 0.9723 119 269 GO:0004375
GO:0005829
GO:0005960
GO:0016594
GO:0019464
GO:0030170
AF-A0A349P8E8-F1-model_v4 Aminomethyl-transferring glycine dehydrogenase subunit GcvPB (EC 1.4.4.2) 0.969 138 321 GO:0004375
GO:0005829
GO:0005960
GO:0016594
GO:0019464
GO:0030170
AF-X0ZTM6-F1-model_v4 Aminotransferase class V domain-containing protein 0.9688 157 385 GO:0004375
GO:0005829
GO:0005960
GO:0016594
GO:0019464
GO:0030170

Map