F077856

General Info

Members Datasets Scaffolds Average Seq Length
114 79 113 115

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_102141631|Ga0068857_1021416311
Length 137
Sequence MIPCKDNALSFRKFCRILYPKTDFMSKKHKGRPDGLVFSTNQDYYNDYQEEQTNAETLPKDKQKLRVKLDTKQRAGKVVTMVDGFVGTSDDLEALGKQLKTKCGTGGSVKDGFVMIQGDYKEKIISWLKEWGYTQTK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
38 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
48 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
54 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
57 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
58 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
59 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
60 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
61 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
62 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
63 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
64 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
65 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
66 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
67 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
68 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
69 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
70 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
71 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
72 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
75 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
76 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
77 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
78 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
79 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.04
Nodule 0
Rhizoplane 2.63
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 16.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1762462 2162886007 Bacteria 256265
2 JGI24740J21852_10044961 3300001979 Bacteria 1307
3 JGI25158J39367_1022099 3300002739 Bacteria 768
4 rootH1_10037951 3300003316 Bacteria 3047
5 rootH1_10078549 3300003316 Bacteria 2789
6 rootH2_10048675 3300003320 Bacteria 2182
7 rootH2_10049363 3300003320 Bacteria 5326
8 rootH2_10050273 3300003320 Bacteria 10173
9 rootH2_10114714 3300003320 Bacteria 2205
10 rootH2_10114715 3300003320 Bacteria 2225
11 rootH2_10143980 3300003320 Bacteria 2743
12 rootL2_10179665 3300003322 Bacteria 1849
13 rootH1_10013293 3300003323 Bacteria 3730
14 rootH1_10052956 3300003323 Bacteria 7878
15 rootH1_10330293 3300003323 Bacteria 1717
16 JGI25160J50197_1001684 3300003354 Bacteria 10774
17 Ga0055526_1011991 3300003771 Bacteria 3834
18 Ga0065165_1006877 3300005262 Bacteria 5782
19 Ga0065165_1033506 3300005262 Bacteria 1598
20 Ga0065704_10000188 3300005289 Bacteria 267216
21 Ga0065704_10110065 3300005289 Bacteria 1989
22 Ga0070658_11246626 3300005327 Bacteria 646
23 Ga0070676_10025255 3300005328 Bacteria 3355
24 Ga0070687_100178699 3300005343 Bacteria 1269
25 Ga0070688_101732067 3300005365 Bacteria 512
26 Ga0068853_100792341 3300005539 Bacteria 907
27 Ga0068853_100895093 3300005539 Unclassified 852
28 Ga0070665_100025350 3300005548 Bacteria 5976
29 Ga0070704_100903272 3300005549 Unclassified 794
30 Ga0068855_100127951 3300005563 Bacteria 2903
31 Ga0068857_100055513 3300005577 Bacteria 3515
32 Ga0068857_100661896 3300005577 Bacteria 990
33 Ga0068857_102141631 3300005577 Bacteria 549
34 Ga0068854_100192367 3300005578 Bacteria 1599
35 Ga0068856_100146715 3300005614 Bacteria 2367
36 Ga0068856_100654682 3300005614 Bacteria 1071
37 Ga0068860_100000394 3300005843 Bacteria 57127
38 Ga0075366_10878785 3300006195 Unclassified 558
39 Ga0075370_10238834 3300006353 Bacteria 1076
40 Ga0105240_10000011 3300009093 Bacteria 523646
41 Ga0105240_10193696 3300009093 Bacteria 2389
42 Ga0105240_12173677 3300009093 Unclassified 576
43 Ga0105240_12241181 3300009093 Bacteria 566
44 Ga0105241_10333395 3300009174 Bacteria 1312
45 Ga0105237_10088012 3300009545 Bacteria 3095
46 Ga0105237_10343502 3300009545 Bacteria 1497
47 Ga0105237_10629911 3300009545 Bacteria 1079
48 Ga0105238_10223129 3300009551 Unclassified 1861
49 Ga0105249_11677960 3300009553 Bacteria 708
50 Ga0105239_10000122 3300010375 Bacteria 109167
51 Ga0105239_10178524 3300010375 Bacteria 2375
52 Ga0105239_11141310 3300010375 Bacteria 897
53 Ga0105239_11277448 3300010375 Bacteria 847
54 Ga0157369_11276938 3300013105 Bacteria 749
55 Ga0157378_10043361 3300013297 Bacteria 3994
56 Ga0157372_10001323 3300013307 Bacteria 26827
57 Ga0157372_10025724 3300013307 Bacteria 6403
58 Ga0213876_10002575 3300021384 Bacteria 10603
59 Ga0209436_100091 3300025208 Bacteria 44391
60 Ga0209436_101285 3300025208 Bacteria 8953
61 Ga0209130_1003551 3300025284 Bacteria 6529
62 Ga0207426_1000024 3300025302 Bacteria 534075
63 Ga0207426_1003178 3300025302 Bacteria 9274
64 Ga0207647_10083334 3300025904 Bacteria 1915
65 Ga0207695_10000010 3300025913 Bacteria 981919
66 Ga0207695_10052664 3300025913 Bacteria 4261
67 Ga0207671_10000056 3300025914 Bacteria 186251
68 Ga0207671_10463788 3300025914 Bacteria 1009
69 Ga0207662_10253558 3300025918 Bacteria 1156
70 Ga0207702_10421435 3300026078 Bacteria 1291
71 Ga0207674_10070018 3300026116 Bacteria 3527
72 Ga0207674_10661470 3300026116 Bacteria 1009
73 Ga0268266_10016719 3300028379 Bacteria 6272
74 Ga0265339_10588388 3300031249 Bacteria 511
75 Ga0265331_10378473 3300031250 Bacteria 634
76 Ga0265327_10000006 3300031251 Bacteria 693716
77 Ga0265327_10005697 3300031251 Bacteria 10282
78 Ga0265314_10193724 3300031711 Bacteria 1207
79 Ga0265314_10631039 3300031711 Bacteria 549
80 Ga0307516_10001546 3300031730 Bacteria 31635
81 Ga0307414_10366111 3300032004 Bacteria 1242
82 Ga0307414_10719617 3300032004 Bacteria 905
83 Ga0436365_0111081 3300039437 Bacteria 39407
84 Ga0436365_1680817 3300039437 Bacteria 1008
85 Ga0439448_0215762 3300042005 Unclassified 674
86 Ga0466972_0095268 3300044658 Bacteria 1410
87 Ga0466968_0168531 3300044735 Bacteria 1014
88 Ga0466968_0506793 3300044735 Unclassified 602
89 Ga0466970_0089522 3300044765 Bacteria 1670
90 Ga0466957_0253598 3300044842 Bacteria 1171
91 Ga0466960_0387626 3300044901 Bacteria 803
92 Ga0495621_0160609 3300046539 Bacteria 888
93 Ga0495633_0456239 3300046558 Bacteria 577
94 Ga0495668_0010706 3300046616 Bacteria 5539
95 Ga0495625_0442075 3300046660 Unclassified 805
96 Ga0495672_0074586 3300047320 Bacteria 1910
97 Ga0495687_000058 3300047443 Bacteria 185830
98 Ga0495686_0003280 3300047472 Bacteria 14150
99 Ga0496102_1502133 3300048905 Unclassified 592
100 Ga0496114_0001644 3300048917 Bacteria 16961
101 Ga0496115_0019877 3300048918 Bacteria 5174
102 Ga0496121_0000082 3300048924 Bacteria 228557
103 Ga0496124_0136530 3300048927 Bacteria 1941
104 Ga0501033_0672954 3300049570 Bacteria 706
105 Ga0501034_0062757 3300049571 Bacteria 3731
106 Ga0501034_0215600 3300049571 Bacteria 1873
107 Ga0501080_0646385 3300049742 Unclassified 936
108 Ga0501080_0759471 3300049742 Bacteria 852
109 Ga0501044_0005264 3300049823 Bacteria 14391
110 Ga0500594_0088613 3300053118 Bacteria 936
111 Ga0500559_0037168 3300053136 Bacteria 2110
112 Ga0500568_0007008 3300053139 Bacteria 5577
113 Ga0500616_0294302 3300053153 Unclassified 677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2929154850 2929159874 108
2 3300003316 rootH1_10037951 rootH1_100379513 110
3 3300003320 rootH2_10048675 rootH2_100486754 110
4 3300003320 rootH2_10050273 rootH2_100502734 110
5 3300003320 rootH2_10114714 rootH2_101147143 110
6 3300003320 rootH2_10114715 rootH2_101147153 110
7 3300003320 rootH2_10143980 rootH2_101439802 110
8 3300003322 rootL2_10179665 rootL2_101796652 110
9 3300003323 rootH1_10013293 rootH1_100132933 110
10 3300003323 rootH1_10330293 rootH1_103302931 110
11 3300003354 JGI25160J50197_1001684 JGI25160J50197_10016847 110
12 3300003771 Ga0055526_1011991 Ga0055526_10119914 110
13 3300005262 Ga0065165_1006877 Ga0065165_10068775 110
14 3300005262 Ga0065165_1033506 Ga0065165_10335062 110
15 3300005539 Ga0068853_100895093 Ga0068853_1008950932 110
16 3300005563 Ga0068855_100127951 Ga0068855_1001279514 110
17 3300005843 Ga0068860_100000394 Ga0068860_10000039449 110
18 3300006353 Ga0075370_10238834 Ga0075370_102388342 110
19 3300009093 Ga0105240_12241181 Ga0105240_122411811 110
20 3300009174 Ga0105241_10333395 Ga0105241_103333952 110
21 3300009551 Ga0105238_10223129 Ga0105238_102231292 110
22 3300009553 Ga0105249_11677960 Ga0105249_116779602 110
23 3300010375 Ga0105239_10178524 Ga0105239_101785243 110
24 3300013307 Ga0157372_10001323 Ga0157372_1000132313 110
25 3300025208 Ga0209436_101285 Ga0209436_1012857 110
26 3300025302 Ga0207426_1003178 Ga0207426_10031788 110
27 3300025904 Ga0207647_10083334 Ga0207647_100833343 110
28 3300031250 Ga0265331_10378473 Ga0265331_103784731 110
29 3300031251 Ga0265327_10005697 Ga0265327_100056975 110
30 3300042005 Ga0439448_0215762 Ga0439448_0215762_259_597 110
31 3300046660 Ga0495625_0442075 Ga0495625_0442075_80_421 110
32 3300047443 Ga0495687_000058 Ga0495687_000058_84993_85334 110
33 3300048917 Ga0496114_0001644 Ga0496114_0001644_14929_15264 110
34 3300048924 Ga0496121_0000082 Ga0496121_0000082_166322_166657 110
35 3300053139 Ga0500568_0007008 Ga0500568_0007008_5191_5532 110
36 3300053153 Ga0500616_0294302 Ga0500616_0294302_160_501 110
37 3300002739 JGI25158J39367_1022099 JGI25158J39367_10220991 111
38 3300003320 rootH2_10049363 rootH2_100493636 111
39 3300003323 rootH1_10052956 rootH1_100529568 111
40 3300005327 Ga0070658_11246626 Ga0070658_112466261 111
41 3300005328 Ga0070676_10025255 Ga0070676_100252554 111
42 3300005539 Ga0068853_100792341 Ga0068853_1007923411 111
43 3300005577 Ga0068857_100055513 Ga0068857_1000555134 111
44 3300025208 Ga0209436_100091 Ga0209436_10009137 111
45 3300025284 Ga0209130_1003551 Ga0209130_10035516 111
46 3300025302 Ga0207426_1000024 Ga0207426_1000024389 111
47 3300026116 Ga0207674_10070018 Ga0207674_100700183 111
48 3300031730 Ga0307516_10001546 Ga0307516_1000154621 111
49 3300044658 Ga0466972_0095268 Ga0466972_0095268_517_855 111
50 3300044735 Ga0466968_0168531 Ga0466968_0168531_202_537 111
51 3300044842 Ga0466957_0253598 Ga0466957_0253598_280_618 111
52 3300046616 Ga0495668_0010706 Ga0495668_0010706_1671_2009 111
53 3300047472 Ga0495686_0003280 Ga0495686_0003280_12479_12817 111
54 3300053118 Ga0500594_0088613 Ga0500594_0088613_492_830 111
55 2162886007 SwRhRL2b_contig_1762462 SwRhRL2b_0592.00002080 112
56 3300001979 JGI24740J21852_10044961 JGI24740J21852_100449612 112
57 3300003316 rootH1_10078549 rootH1_100785492 112
58 3300005289 Ga0065704_10000188 Ga0065704_1000018812 112
59 3300005289 Ga0065704_10110065 Ga0065704_101100653 112
60 3300005343 Ga0070687_100178699 Ga0070687_1001786991 112
61 3300005365 Ga0070688_101732067 Ga0070688_1017320671 112
62 3300005548 Ga0070665_100025350 Ga0070665_1000253509 112
63 3300005549 Ga0070704_100903272 Ga0070704_1009032721 112
64 3300005577 Ga0068857_100661896 Ga0068857_1006618962 112
65 3300005577 Ga0068857_102141631 Ga0068857_1021416311 112
66 3300005578 Ga0068854_100192367 Ga0068854_1001923673 112
67 3300005614 Ga0068856_100146715 Ga0068856_1001467151 112
68 3300005614 Ga0068856_100654682 Ga0068856_1006546823 112
69 3300006195 Ga0075366_10878785 Ga0075366_108787851 112
70 3300009093 Ga0105240_10000011 Ga0105240_1000001197 112
71 3300009093 Ga0105240_10193696 Ga0105240_101936962 112
72 3300009093 Ga0105240_12173677 Ga0105240_121736772 112
73 3300009545 Ga0105237_10088012 Ga0105237_100880124 112
74 3300009545 Ga0105237_10343502 Ga0105237_103435022 112
75 3300009545 Ga0105237_10629911 Ga0105237_106299112 112
76 3300010375 Ga0105239_10000122 Ga0105239_1000012266 112
77 3300010375 Ga0105239_11141310 Ga0105239_111413102 112
78 3300010375 Ga0105239_11277448 Ga0105239_112774481 112
79 3300013105 Ga0157369_11276938 Ga0157369_112769382 112
80 3300013297 Ga0157378_10043361 Ga0157378_100433615 112
81 3300013307 Ga0157372_10025724 Ga0157372_100257243 112
82 3300021384 Ga0213876_10002575 Ga0213876_100025758 112
83 3300025913 Ga0207695_10000010 Ga0207695_10000010485 112
84 3300025913 Ga0207695_10052664 Ga0207695_100526645 112
85 3300025914 Ga0207671_10000056 Ga0207671_10000056166 112
86 3300025914 Ga0207671_10463788 Ga0207671_104637882 112
87 3300025918 Ga0207662_10253558 Ga0207662_102535581 112
88 3300026078 Ga0207702_10421435 Ga0207702_104214352 112
89 3300026116 Ga0207674_10661470 Ga0207674_106614702 112
90 3300028379 Ga0268266_10016719 Ga0268266_100167199 112
91 3300031249 Ga0265339_10588388 Ga0265339_105883881 112
92 3300031251 Ga0265327_10000006 Ga0265327_10000006319 112
93 3300031711 Ga0265314_10193724 Ga0265314_101937243 112
94 3300031711 Ga0265314_10631039 Ga0265314_106310391 112
95 3300032004 Ga0307414_10366111 Ga0307414_103661112 112
96 3300032004 Ga0307414_10719617 Ga0307414_107196172 112
97 3300039437 Ga0436365_0111081 Ga0436365_0111081_23243_23587 112
98 3300039437 Ga0436365_1680817 Ga0436365_1680817_240_584 112
99 3300044735 Ga0466968_0506793 Ga0466968_0506793_218_586 112
100 3300044765 Ga0466970_0089522 Ga0466970_0089522_443_784 112
101 3300044901 Ga0466960_0387626 Ga0466960_0387626_285_635 112
102 3300046539 Ga0495621_0160609 Ga0495621_0160609_171_509 112
103 3300046558 Ga0495633_0456239 Ga0495633_0456239_170_547 112
104 3300047320 Ga0495672_0074586 Ga0495672_0074586_609_953 112
105 3300048905 Ga0496102_1502133 Ga0496102_1502133_110_520 112
106 3300048918 Ga0496115_0019877 Ga0496115_0019877_2632_2973 112
107 3300048927 Ga0496124_0136530 Ga0496124_0136530_663_1007 112
108 3300049570 Ga0501033_0672954 Ga0501033_0672954_235_585 112
109 3300049571 Ga0501034_0062757 Ga0501034_0062757_1999_2349 112
110 3300049571 Ga0501034_0215600 Ga0501034_0215600_912_1256 112
111 3300049742 Ga0501080_0646385 Ga0501080_0646385_518_862 112
112 3300049742 Ga0501080_0759471 Ga0501080_0759471_203_553 112
113 3300049823 Ga0501044_0005264 Ga0501044_0005264_4484_4834 112
114 3300053136 Ga0500559_0037168 Ga0500559_0037168_1617_1964 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01253

SUI1

Translation initiation factor SUI1

61

134

0.97

Feature Viewer

pLDDT pTM Quality
66.36 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map