F076333

General Info

Members Datasets Scaffolds Average Seq Length
113 100 226 381

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2862290372|2862291810
Length 430
Sequence RTRTDSRTDSRTGFRNRSITLLSIGHACVDVYQGAVASLVPFFVAERAYTYAAASGIVLAASLLSSVAQPVFGILTDRRAMPWLLPVSTVLGGLGIAASGLTGSYGLTLAFVAVSGIGVAAYHPESARVARLASGGSHSAMAWFSLGGNLGFAAAPLMVTAVVATGGLRLTPLLVLPALAGSVLCLPVLRALARDGHGGSGGTFAAGPDDRRSFVKLSLAVVCRSIVFVGLSTFVALYVKERMGGSTAAGTAALFVLYLGGAVGSVLGGSLAGRWDRVTVAGSSYLVSVFAVAGIVFVPGPAVYAFVALTSIGLYVPFSLQVTLGQDYLPSRVGTASGITLGLTVSIGGLAGPLVGRLADATSLRTALTPLIVMPVLSWLLFRSLPEPAAPQAAVTPPAVAPPTVTPPSRAARGARSAPADDRGSSRNSS

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
17 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
18 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
19 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
20 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
21 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
28 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
29 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
30 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
33 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
34 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
35 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
36 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
37 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
38 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
39 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
40 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
41 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
42 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
43 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
44 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
45 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
46 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
47 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
48 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
49 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
50 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
51 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
52 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
53 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
54 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
55 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
57 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
58 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
59 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
60 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
61 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
62 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
63 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
64 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
65 2643221647 Streptomyces sp. Root369 Isolate Unclassified
66 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
67 2643221692 Nocardia sp. Root136 Isolate Unclassified
68 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
69 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
70 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
71 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
72 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
73 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
74 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
75 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
76 2867428634 Streptomyces sp. RP5T Isolate Unclassified
77 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
78 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
79 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
80 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
81 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
82 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
83 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
84 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
85 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
86 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
87 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
88 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
89 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
90 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
91 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
92 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
93 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
94 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
95 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
96 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
97 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
98 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
99 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
100 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 63.72
Metatranscriptomes 1.77
Isolates 34.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.96
Nodule 0.88
Rhizoplane 0.88
Rhizosphere 61.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10003413 3300003320 Bacteria 2602
2 Ga0070658_10042226 3300005327 Bacteria 3682
3 Ga0070680_100055693 3300005336 Bacteria 3232
4 Ga0070714_100084712 3300005435 Bacteria 2767
5 Ga0070713_100134583 3300005436 Bacteria 2183
6 Ga0070681_10165203 3300005458 Bacteria 2136
7 Ga0070684_100273940 3300005535 Bacteria 1545
8 Ga0068855_100066324 3300005563 Bacteria 4208
9 Ga0068856_100287592 3300005614 Bacteria 1661
10 Ga0075368_10013263 3300006042 Bacteria 3024
11 Ga0075363_100016180 3300006048 Bacteria 3681
12 Ga0070716_100082776 3300006173 Bacteria 1920
13 Ga0075367_10000602 3300006178 Bacteria 13819
14 Ga0157369_10007167 3300013105 Bacteria 12849
15 Ga0157372_10264752 3300013307 Bacteria 1996
16 Ga0163163_10292243 3300014325 Bacteria 1682
17 Ga0206356_10520917 3300020070 Bacteria 2036
18 Ga0206354_11302737 3300020081 Bacteria 1838
19 Ga0209758_1009122 3300025297 Bacteria 6251
20 Ga0207426_1000751 3300025302 Bacteria 36444
21 Ga0207647_10004105 3300025904 Bacteria 10809
22 Ga0207705_10097104 3300025909 Bacteria 2163
23 Ga0207707_10224147 3300025912 Bacteria 1636
24 Ga0207700_10107149 3300025928 Bacteria 2242
25 Ga0207667_10051213 3300025949 Bacteria 4354
26 Ga0207674_10035889 3300026116 Bacteria 5171
27 Ga0307515_10018080 3300028794 Bacteria 12792
28 Ga0307515_10026465 3300028794 Bacteria 9983
29 Ga0307515_10145977 3300028794 Bacteria 2505
30 Ga0307512_10004421 3300030522 Bacteria 15422
31 Ga0307512_10007825 3300030522 Bacteria 10515
32 Ga0307512_10010048 3300030522 Bacteria 9061
33 Ga0307513_10000693 3300031456 Bacteria 48399
34 Ga0307513_10020963 3300031456 Bacteria 7731
35 Ga0307513_10027371 3300031456 Bacteria 6548
36 Ga0307509_10014326 3300031507 Bacteria 9328
37 Ga0307508_10002009 3300031616 Bacteria 22192
38 Ga0307508_10029202 3300031616 Bacteria 4986
39 Ga0307514_10001855 3300031649 Bacteria 23367
40 Ga0307516_10004068 3300031730 Bacteria 18304
41 Ga0307516_10009196 3300031730 Bacteria 11061
42 Ga0307518_10006262 3300031838 Bacteria 8524
43 Ga0439449_0002884 3300042007 Bacteria 6688
44 Ga0466972_0008213 3300044658 Bacteria 5233
45 Ga0466965_0078389 3300044683 Bacteria 1669
46 Ga0466971_0007009 3300044719 Bacteria 4906
47 Ga0466970_0013858 3300044765 Bacteria 4136
48 Ga0466960_0002009 3300044901 Bacteria 7547
49 Ga0495687_011569 3300047443 Bacteria 4734
50 Ga0496109_0020342 3300048912 Bacteria 5862
51 Ga0501032_0006785 3300049569 Bacteria 8400
52 Ga0501036_0001039 3300049572 Bacteria 20946
53 Ga0501038_0001154 3300049574 Bacteria 23957
54 Ga0501038_0015657 3300049574 Bacteria 6893
55 Ga0501038_0124362 3300049574 Bacteria 2124
56 Ga0501041_0002172 3300049577 Bacteria 11067
57 Ga0501043_0090593 3300049579 Bacteria 2404
58 Ga0501046_0007048 3300049580 Bacteria 9901
59 Ga0501047_0008036 3300049581 Bacteria 9952
60 Ga0501047_0054994 3300049581 Bacteria 3849
61 Ga0501047_0057821 3300049581 Bacteria 3749
62 Ga0501047_0077215 3300049581 Bacteria 3205
63 Ga0501068_0033364 3300049584 Bacteria 3065
64 Ga0501071_0003685 3300049587 Bacteria 9613
65 Ga0501072_0010772 3300049588 Bacteria 6968
66 Ga0501076_0182476 3300049592 Bacteria 1711
67 Ga0501077_0073293 3300049593 Bacteria 2169
68 Ga0501035_0252972 3300049822 Bacteria 1495
69 Ga0501044_0016144 3300049823 Bacteria 8026
70 nmdc:mga06z11_1415_c1 3300050494 Bacteria 8917
71 nmdc:mga04h51_18012_c1 3300050495 Bacteria 2074
72 Ga0500651_0096005 3300053093 Bacteria 1822
73 Ga0500577_0057012 3300053142 Bacteria 1489
74 Ga0501082_0006599 3300060353 Bacteria 10039
75 2862291810 2862290372 Bacteria 7471434
76 2585311070 2582581313 Bacteria 10042643
77 2616903458 2616644941 Bacteria 8510691
78 2644266368 2643221647 Bacteria 10741251
79 2644441015 2643221678 Bacteria 9540101
80 2644513100 2643221692 Bacteria 7282860
81 2676487860 2675903060 Bacteria 10051191
82 2785366116 2784746768 Bacteria 10036182
83 2808846722 2808606359 Bacteria 9866990
84 2812361659 2811994879 Bacteria 9313447
85 2861524089 2861520306 Bacteria 8348283
86 2862282277 2862281513 Bacteria 9621493
87 2866612167 2866612099 Bacteria 7543886
88 2867303180 2867302475 Bacteria 7087181
89 2867431840 2867428634 Bacteria 9590268
90 2868088766 2868088558 Bacteria 7609351
91 2877676928 2877676314 Bacteria 9512378
92 2880490736 2880489317 Bacteria 7096270
93 2899359801 2899359706 Bacteria 10940472
94 2912715666 2912715099 Bacteria 9460473
95 2946064506 2946064051 Bacteria 8957905
96 2947224452 2947224130 Bacteria 9938529
97 2954389738 2954380949 Bacteria 10050426
98 2954700580 2954691527 Bacteria 10720516
99 2954701649 2954701450 Bacteria 10834262
100 2954719244 2954711539 Bacteria 10867210
101 2954729216 2954721474 Bacteria 10456478
102 2954732594 2954731030 Bacteria 10243860
103 2954748116 2954740390 Bacteria 10229294
104 2954751473 2954749733 Bacteria 10366972
105 2954767240 2954759201 Bacteria 9358192
106 3006494065 3006493962 Bacteria 8825450
107 8023624887 8023623736 Bacteria 8593882
108 8025485338 8025478263 Bacteria 8209203
109 8025535015 8025530807 Bacteria 8495698
110 8054163950 8054160619 Bacteria 7783213
111 8054705719 8054704163 Bacteria 7247792
112 8056447364 8056447290 Bacteria 7680491
113 8056671616 8056667051 Bacteria 6953971
114 rootH2_10003413
115 Ga0070658_10042226
116 Ga0070680_100055693
117 Ga0070714_100084712
118 Ga0070713_100134583
119 Ga0070681_10165203
120 Ga0070684_100273940
121 Ga0068855_100066324
122 Ga0068856_100287592
123 Ga0075368_10013263
124 Ga0075363_100016180
125 Ga0070716_100082776
126 Ga0075367_10000602
127 Ga0157369_10007167
128 Ga0157372_10264752
129 Ga0163163_10292243
130 Ga0206356_10520917
131 Ga0206354_11302737
132 Ga0209758_1009122
133 Ga0207426_1000751
134 Ga0207647_10004105
135 Ga0207705_10097104
136 Ga0207707_10224147
137 Ga0207700_10107149
138 Ga0207667_10051213
139 Ga0207674_10035889
140 Ga0307515_10018080
141 Ga0307515_10026465
142 Ga0307515_10145977
143 Ga0307512_10004421
144 Ga0307512_10007825
145 Ga0307512_10010048
146 Ga0307513_10000693
147 Ga0307513_10020963
148 Ga0307513_10027371
149 Ga0307509_10014326
150 Ga0307508_10002009
151 Ga0307508_10029202
152 Ga0307514_10001855
153 Ga0307516_10004068
154 Ga0307516_10009196
155 Ga0307518_10006262
156 Ga0439449_0002884
157 Ga0466972_0008213
158 Ga0466965_0078389
159 Ga0466971_0007009
160 Ga0466970_0013858
161 Ga0466960_0002009
162 Ga0495687_011569
163 Ga0496109_0020342
164 Ga0501032_0006785
165 Ga0501036_0001039
166 Ga0501038_0001154
167 Ga0501038_0015657
168 Ga0501038_0124362
169 Ga0501041_0002172
170 Ga0501043_0090593
171 Ga0501046_0007048
172 Ga0501047_0008036
173 Ga0501047_0054994
174 Ga0501047_0057821
175 Ga0501047_0077215
176 Ga0501068_0033364
177 Ga0501071_0003685
178 Ga0501072_0010772
179 Ga0501076_0182476
180 Ga0501077_0073293
181 Ga0501035_0252972
182 Ga0501044_0016144
183 nmdc:mga06z11_1415_c1
184 nmdc:mga04h51_18012_c1
185 Ga0500651_0096005
186 Ga0500577_0057012
187 Ga0501082_0006599
188 2862291810
189 2585311070
190 2616903458
191 2644266368
192 2644441015
193 2644513100
194 2676487860
195 2785366116
196 2808846722
197 2812361659
198 2861524089
199 2862282277
200 2866612167
201 2867303180
202 2867431840
203 2868088766
204 2877676928
205 2880490736
206 2899359801
207 2912715666
208 2946064506
209 2947224452
210 2954389738
211 2954700580
212 2954701649
213 2954719244
214 2954729216
215 2954732594
216 2954748116
217 2954751473
218 2954767240
219 3006494065
220 8023624887
221 8025485338
222 8025535015
223 8054163950
224 8054705719
225 8056447364
226 8056671616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

22

353

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.5076 11 363
8omu-assembly1.cif.gz_A cryo-em structure of rat slc22a6 bound to alpha-ketoglutaric acid in a low occupancy state 0.5035 48 360
8sdz-assembly1.cif.gz_A structure of rat organic anion transporter 1 (oat1) in complex with probenecid 0.5001 39 361
8hpj-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in a ligand-free outward-facing form 0.4951 13 358
8bvt-assembly1.cif.gz_A cryo-em structure of rat slc22a6 bound to probenecid 0.4923 48 360
ID Description Score Start End Superfamily
af_P52067_17_206_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9278 10 161 1.20.1250.20
af_Q5RGT2_295_489_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9118 186 359 1.20.1250.20
af_O01735_368_566_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9071 188 359 1.20.1250.20
af_Q8MP22_241_464_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9046 186 359 1.20.1250.20
af_P17583_194_375_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9043 185 359 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6N9UQF2-F1-model_v4 MFS transporter 0.9864 185 362 GO:0005886
GO:0022857
AF-A0A2I0SU60-F1-model_v4 MFS transporter 0.9736 176 362 GO:0005886
GO:0022857
AF-W5XUR6-F1-model_v4 deleted 0.964 186 362
AF-A0A6G3WYR3-F1-model_v4 MFS transporter 0.9564 173 364 GO:0005886
AF-A0A6G3T5D6-F1-model_v4 MFS transporter 0.956 173 350 GO:0005886
GO:0022857

Map