F074488

General Info

Members Datasets Scaffolds Average Seq Length
113 92 103 309

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10000809|Ga0307515_1000080953
Length 351
Sequence MSGLNIIYLKHFFTLLGRITFKKNYRSGFVPLILSLHMKTAQKPIHSGFNANSTAAEVAAGHNLTGKIALVTGGNSGIGYETVKTLADIGAHVVVGARDAGKSAERLAGFKNVSFIPLDLADPASVDAFAERFLAEYDSLHLLVNNAGLYRPPQFIKDKRGFELQFGVNYLGHFQLTGRLWPALKNVGGARVVALSSIGHRYMGLQLDDPNFEKHPFDKSKAYGQSKTATSLFAVELDRLGQEHNIRAFAVHPGAILTDAFRYMTAEEVQAWAQRVKGIKTTQQGAATSIWCALSYQLNDMGGVYCEDCDIAELVPDDLQAGYGVRSFAIDPDQATALWQFSEKVTGVIYG

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
3 2818991437 Pedobacter terrae 518 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
6 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
7 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
8 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
9 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
37 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
38 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
39 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
41 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
42 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
44 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
60 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
61 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
62 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
63 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
64 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
65 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
66 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
67 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
68 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
69 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
70 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
71 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
72 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
73 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
74 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
75 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
76 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
77 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
78 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
82 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
83 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
84 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
85 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
86 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
87 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
88 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
89 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
90 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
91 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
92 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.15
Metatranscriptomes 0
Isolates 8.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.55
Nodule 0
Rhizoplane 7.08
Rhizosphere 41.59
Stem 0
Stem Tuber 0
Unclassified 24.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013425 3300001979 Bacteria 3054
2 JGI25162J39368_1001001 3300002737 Bacteria 17716
3 JGI25154J39366_1000025 3300002738 Bacteria 211189
4 JGI25165J46597_1000519 3300003214 Bacteria 36430
5 JGI25153J46596_10000818 3300003215 Bacteria 19026
6 rootH1_10038007 3300003316 Bacteria 2015
7 rootH1_10153595 3300003316 Archaea 1121
8 rootH2_10011170 3300003320 Bacteria 7595
9 rootL2_10017585 3300003322 Bacteria 5416
10 rootL2_10092734 3300003322 Bacteria 5179
11 rootL2_10125613 3300003322 Unclassified 1517
12 rootH1_10016916 3300003323 Bacteria 9365
13 rootH1_10050456 3300003323 Bacteria 2357
14 rootH1_10094394 3300003323 Bacteria 6733
15 rootH1_10147497 3300003323 Bacteria 4285
16 rootH1_10207759 3300003323 Unclassified 4568
17 rootH1_10280973 3300003323 Unclassified 4857
18 rootH1_10309621 3300003323 Bacteria 2557
19 rootH1_10322981 3300003323 Bacteria 3917
20 JGI25160J50197_1004051 3300003354 Bacteria 6386
21 Ga0055542_1004405 3300003762 Bacteria 3437
22 Ga0065714_10064880 3300005288 Bacteria 16161
23 Ga0070666_10233895 3300005335 Unclassified 1298
24 Ga0070681_10205969 3300005458 Unclassified 1884
25 Ga0070665_100002844 3300005548 Bacteria 18745
26 Ga0068860_100000053 3300005843 Bacteria 207331
27 Ga0075364_10014079 3300006051 Bacteria 4934
28 Ga0097621_100223940 3300006237 Bacteria 1640
29 Ga0105244_10060696 3300009036 Bacteria 1904
30 Ga0105240_10000152 3300009093 Bacteria 141054
31 Ga0105240_10609083 3300009093 Bacteria 1202
32 Ga0105239_10002214 3300010375 Bacteria 24975
33 Ga0105239_10323528 3300010375 Bacteria 1739
34 Ga0157373_10032731 3300013100 Bacteria 3742
35 Ga0157370_10000166 3300013104 Bacteria 81040
36 Ga0157370_10042431 3300013104 Unclassified 4384
37 Ga0163162_10073573 3300013306 Bacteria 3473
38 Ga0157372_10239036 3300013307 Bacteria 2107
39 Ga0163161_10000215 3300017792 Bacteria 52730
40 Ga0209436_101823 3300025208 Bacteria 6906
41 Ga0207427_100103 3300025231 Bacteria 119618
42 Ga0209437_100101 3300025233 Bacteria 226668
43 Ga0209258_100193 3300025242 Bacteria 124682
44 Ga0209646_1000037 3300025246 Bacteria 355116
45 Ga0209646_1003415 3300025246 Bacteria 3141
46 Ga0209026_1000256 3300025250 Bacteria 66551
47 Ga0209148_1000167 3300025254 Bacteria 135407
48 Ga0209233_1000124 3300025261 Bacteria 226743
49 Ga0209130_1000735 3300025284 Bacteria 28852
50 Ga0209758_1003695 3300025297 Bacteria 13591
51 Ga0209050_1010400 3300025298 Bacteria 4591
52 Ga0207426_1000034 3300025302 Bacteria 454016
53 Ga0207426_1000489 3300025302 Bacteria 59657
54 Ga0209257_1027904 3300025304 Bacteria 1868
55 Ga0207655_1070502 3300025728 Bacteria 1301
56 Ga0207647_10033792 3300025904 Bacteria 3270
57 Ga0207695_10000185 3300025913 Bacteria 180225
58 Ga0207639_10453245 3300026041 Unclassified 1165
59 Ga0268266_10020148 3300028379 Bacteria 5685
60 Ga0268264_10000098 3300028381 Bacteria 229055
61 Ga0307515_10000809 3300028794 Bacteria 72176
62 Ga0265327_10015851 3300031251 Bacteria 4832
63 Ga0395898_0075995 3300037466 Bacteria 3244
64 Ga0395901_0013823 3300038443 Bacteria 8211
65 Ga0495627_000132 3300046453 Bacteria 90039
66 Ga0495638_0000020 3300046460 Bacteria 372434
67 Ga0495585_0002448 3300046492 Bacteria 13297
68 Ga0495607_0012032 3300046501 Bacteria 5726
69 Ga0495606_0006603 3300046507 Bacteria 10654
70 Ga0495606_0039870 3300046507 Bacteria 3159
71 Ga0495610_0000151 3300046512 Bacteria 76854
72 Ga0495648_0015145 3300046524 Bacteria 5615
73 Ga0495609_0051479 3300046538 Bacteria 1833
74 Ga0495622_0031090 3300046557 Bacteria 2496
75 Ga0495668_0002438 3300046616 Bacteria 15288
76 Ga0495625_0000376 3300046660 Bacteria 68173
77 Ga0495687_000006 3300047443 Bacteria 571936
78 Ga0496104_0030554 3300048907 Bacteria 5007
79 Ga0496104_0187557 3300048907 Bacteria 1979
80 Ga0496105_0017546 3300048908 Bacteria 5742
81 Ga0496109_0194512 3300048912 Bacteria 1906
82 Ga0496109_0457756 3300048912 Bacteria 1205
83 Ga0496111_0100644 3300048914 Bacteria 2123
84 Ga0496112_0013829 3300048915 Bacteria 7466
85 Ga0496113_0064578 3300048916 Bacteria 2768
86 Ga0496121_0099085 3300048924 Bacteria 2253
87 Ga0496124_0000013 3300048927 Bacteria 484884
88 Ga0501034_0003227 3300049571 Bacteria 18669
89 Ga0501034_0380822 3300049571 Bacteria 1336
90 Ga0501043_0053873 3300049579 Bacteria 3159
91 Ga0501047_0107840 3300049581 Bacteria 2667
92 Ga0500643_000312 3300053087 Bacteria 39897
93 Ga0500583_0003128 3300053092 Bacteria 5131
94 Ga0500562_000198 3300053108 Bacteria 16330
95 Ga0500614_004279 3300053123 Bacteria 3030
96 Ga0500568_0103611 3300053139 Bacteria 1066
97 Ga0500616_0000007 3300053153 Bacteria 836875
98 Ga0500616_0079986 3300053153 Bacteria 1644
99 Ga0500622_0000925 3300053156 Bacteria 24930
100 Ga0500622_0024596 3300053156 Unclassified 3184
101 Ga0500636_0083718 3300053177 Unclassified 1835
102 Ga0500645_009407 3300053730 Bacteria 3283
103 Ga0500661_011681 3300055283 Bacteria 1587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0194512 Ga0496109_0194512_17_853 268
2 3300010375 Ga0105239_10002214 Ga0105239_100022149 275
3 3300025298 Ga0209050_1010400 Ga0209050_10104004 284
4 3300025304 Ga0209257_1027904 Ga0209257_10279042 284
5 iso_pu_bacteria 2818991437 2819548608 286
6 iso_pu_bacteria 2818991444 2819587849 286
7 iso_pu_bacteria 2929177148 2929181001 287
8 iso_pu_bacteria 2945977869 2945983401 287
9 iso_pu_bacteria 2946013367 2946017207 287
10 3300003762 Ga0055542_1004405 Ga0055542_10044053 288
11 3300025242 Ga0209258_100193 Ga0209258_100193114 288
12 3300025254 Ga0209148_1000167 Ga0209148_10001672 288
13 3300055283 Ga0500661_011681 Ga0500661_011681_116_1018 288
14 3300005548 Ga0070665_100002844 Ga0070665_10000284412 289
15 3300006237 Ga0097621_100223940 Ga0097621_1002239403 289
16 3300009093 Ga0105240_10609083 Ga0105240_106090831 289
17 3300010375 Ga0105239_10323528 Ga0105239_103235281 289
18 3300013100 Ga0157373_10032731 Ga0157373_100327312 289
19 3300025246 Ga0209646_1003415 Ga0209646_10034155 289
20 3300025904 Ga0207647_10033792 Ga0207647_100337923 289
21 3300028379 Ga0268266_10020148 Ga0268266_100201483 289
22 3300031251 Ga0265327_10015851 Ga0265327_100158512 289
23 3300049579 Ga0501043_0053873 Ga0501043_0053873_81_1034 289
24 3300002737 JGI25162J39368_1001001 JGI25162J39368_100100121 290
25 3300003214 JGI25165J46597_1000519 JGI25165J46597_100051931 290
26 3300003316 rootH1_10038007 rootH1_100380071 290
27 3300003316 rootH1_10153595 rootH1_101535951 290
28 3300003320 rootH2_10011170 rootH2_100111706 290
29 3300003322 rootL2_10017585 rootL2_100175853 290
30 3300003322 rootL2_10092734 rootL2_100927344 290
31 3300003322 rootL2_10125613 rootL2_101256132 290
32 3300003323 rootH1_10016916 rootH1_100169161 290
33 3300003323 rootH1_10050456 rootH1_100504563 290
34 3300003323 rootH1_10094394 rootH1_100943943 290
35 3300003323 rootH1_10280973 rootH1_102809733 290
36 3300003323 rootH1_10309621 rootH1_103096212 290
37 3300003323 rootH1_10322981 rootH1_103229814 290
38 3300005288 Ga0065714_10064880 Ga0065714_100648802 290
39 3300005335 Ga0070666_10233895 Ga0070666_102338952 290
40 3300009036 Ga0105244_10060696 Ga0105244_100606962 290
41 3300013104 Ga0157370_10000166 Ga0157370_1000016658 290
42 3300013104 Ga0157370_10042431 Ga0157370_100424315 290
43 3300013306 Ga0163162_10073573 Ga0163162_100735731 290
44 3300017792 Ga0163161_10000215 Ga0163161_1000021512 290
45 3300025231 Ga0207427_100103 Ga0207427_10010352 290
46 3300025233 Ga0209437_100101 Ga0209437_10010173 290
47 3300025261 Ga0209233_1000124 Ga0209233_1000124163 290
48 3300025728 Ga0207655_1070502 Ga0207655_10705021 290
49 3300026041 Ga0207639_10453245 Ga0207639_104532452 290
50 3300046460 Ga0495638_0000020 Ga0495638_0000020_50985_51887 290
51 3300046507 Ga0495606_0006603 Ga0495606_0006603_4756_5655 290
52 3300046507 Ga0495606_0039870 Ga0495606_0039870_2020_2922 290
53 3300046512 Ga0495610_0000151 Ga0495610_0000151_34566_35465 290
54 3300053108 Ga0500562_000198 Ga0500562_000198_2024_2926 290
55 3300053153 Ga0500616_0000007 Ga0500616_0000007_788897_789799 290
56 3300053156 Ga0500622_0000925 Ga0500622_0000925_11667_12572 290
57 3300053730 Ga0500645_009407 Ga0500645_009407_2017_2919 290
58 3300053153 Ga0500616_0079986 Ga0500616_0079986_95_997 291
59 3300053156 Ga0500622_0024596 Ga0500622_0024596_645_1547 291
60 3300006051 Ga0075364_10014079 Ga0075364_100140795 292
61 3300053087 Ga0500643_000312 Ga0500643_000312_29294_30208 292
62 3300053139 Ga0500568_0103611 Ga0500568_0103611_80_1012 292
63 3300046501 Ga0495607_0012032 Ga0495607_0012032_2645_3685 301
64 3300046538 Ga0495609_0051479 Ga0495609_0051479_278_1183 301
65 3300053092 Ga0500583_0003128 Ga0500583_0003128_2057_3040 302
66 3300053177 Ga0500636_0083718 Ga0500636_0083718_505_1491 302
67 iso_pu_bacteria 2547132424 2548697967 303
68 iso_pu_bacteria 2767802112 2768644190 303
69 iso_pu_bacteria 2857542790 2857543098 303
70 3300049571 Ga0501034_0003227 Ga0501034_0003227_7005_7958 304
71 3300046453 Ga0495627_000132 Ga0495627_000132_58663_59703 306
72 3300046524 Ga0495648_0015145 Ga0495648_0015145_1762_2802 306
73 3300048924 Ga0496121_0099085 Ga0496121_0099085_830_1807 307
74 3300048927 Ga0496124_0000013 Ga0496124_0000013_132395_133372 307
75 3300013307 Ga0157372_10239036 Ga0157372_102390364 308
76 3300048907 Ga0496104_0030554 Ga0496104_0030554_3425_4381 308
77 3300048907 Ga0496104_0187557 Ga0496104_0187557_338_1294 308
78 3300048908 Ga0496105_0017546 Ga0496105_0017546_1933_2889 308
79 3300048912 Ga0496109_0457756 Ga0496109_0457756_40_996 308
80 3300048914 Ga0496111_0100644 Ga0496111_0100644_527_1483 308
81 3300048915 Ga0496112_0013829 Ga0496112_0013829_4449_5405 308
82 3300048916 Ga0496113_0064578 Ga0496113_0064578_272_1228 308
83 3300037466 Ga0395898_0075995 Ga0395898_0075995_1142_2107 311
84 3300038443 Ga0395901_0013823 Ga0395901_0013823_5501_6466 311
85 iso_pu_bacteria 2929921140 2929925879 311
86 iso_pu_bacteria 8003151029 8003153154 311
87 3300003323 rootH1_10147497 rootH1_101474972 314
88 3300005458 Ga0070681_10205969 Ga0070681_102059692 314
89 3300005843 Ga0068860_100000053 Ga0068860_10000005331 314
90 3300009093 Ga0105240_10000152 Ga0105240_1000015293 314
91 3300025208 Ga0209436_101823 Ga0209436_1018232 314
92 3300025284 Ga0209130_1000735 Ga0209130_100073513 314
93 3300025302 Ga0207426_1000034 Ga0207426_1000034123 314
94 3300025913 Ga0207695_10000185 Ga0207695_1000018592 314
95 3300028381 Ga0268264_10000098 Ga0268264_1000009830 314
96 3300028794 Ga0307515_10000809 Ga0307515_1000080953 314
97 3300046492 Ga0495585_0002448 Ga0495585_0002448_2101_3045 314
98 3300046557 Ga0495622_0031090 Ga0495622_0031090_246_1190 314
99 3300046616 Ga0495668_0002438 Ga0495668_0002438_8044_8988 314
100 3300046660 Ga0495625_0000376 Ga0495625_0000376_25623_26567 314
101 3300047443 Ga0495687_000006 Ga0495687_000006_502023_502967 314
102 3300049571 Ga0501034_0380822 Ga0501034_0380822_36_980 314
103 3300049581 Ga0501047_0107840 Ga0501047_0107840_1627_2571 314
104 3300053123 Ga0500614_004279 Ga0500614_004279_2057_3001 314
105 3300001979 JGI24740J21852_10013425 JGI24740J21852_100134253 315
106 3300002738 JGI25154J39366_1000025 JGI25154J39366_1000025155 315
107 3300003215 JGI25153J46596_10000818 JGI25153J46596_100008186 315
108 3300003323 rootH1_10207759 rootH1_102077594 315
109 3300003354 JGI25160J50197_1004051 JGI25160J50197_10040514 315
110 3300025246 Ga0209646_1000037 Ga0209646_1000037158 315
111 3300025250 Ga0209026_1000256 Ga0209026_10002569 315
112 3300025297 Ga0209758_1003695 Ga0209758_10036956 315
113 3300025302 Ga0207426_1000489 Ga0207426_100048915 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

67

269

0.89

PF08659

KR

KR domain

68

161

0.85

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

73

296

0.81

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

69

259

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3grp-assembly1.cif.gz_D 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.8638 26 270
8u9a-assembly1.cif.gz_B crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (dbh bound) 0.8577 24 271
3emk-assembly1.cif.gz_D 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.8574 26 271
3emk-assembly1.cif.gz_A 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.8539 26 270
3enn-assembly1.cif.gz_B 2.1a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis (p43212) 0.8528 26 271
ID Description Score Start End Superfamily
af_A0A1D6F4K7_21_149_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9183 30 112 3.40.50.720
af_Q9VE80_46_330_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9092 25 313 3.40.50.720
af_F1Q911_35_322_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9089 22 312 3.40.50.720
af_Q9W404_65_353_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9074 25 312 3.40.50.720
af_A0A0P0WC51_15_133_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9062 30 106 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7L7THS8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9587 1 314 GO:0016491
AF-A0A667YLY6-F1-model_v4 Zgc:153441 0.9584 23 209 GO:0016491
AF-A0A838V684-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9565 6 309
AF-A0A5E4WMD2-F1-model_v4 Short-chain dehydrogenase 0.9563 3 315
AF-A0A317V7Q0-F1-model_v4 Retinol dehydrogenase 0.9557 15 315

Feature Viewer

pLDDT pTM Quality
91.79 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map