F072944

General Info

Members Datasets Scaffolds Average Seq Length
113 73 226 140

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100667812|Ga0070679_1006678122
Length 156
Sequence VKSSGHDKALQIGYNAYMLRTTPFLLFDGNCAEVMTFYHECLGGELTVTKLGDTPMKDQFPPEKHGRVINAHLTSGDIAISATDWMASPDFDPVQGNTYAIFITGDSYDELKSVVDKLKDGGNNTRLQELHEMPFGIYGQFYDKYGVQWIFRGGKV

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
3 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
54 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
55 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
56 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
65 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
66 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
67 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
73 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.19
Nodule 0
Rhizoplane 2.65
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 30.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100667812 3300005530 Bacteria 982
2 Ga0055539_1000267 3300003752 Bacteria 31502
3 Ga0055533_1000006 3300003756 Bacteria 635559
4 Ga0055525_1000601 3300003759 Bacteria 15226
5 Ga0065704_10257171 3300005289 Bacteria 974
6 Ga0070658_10027344 3300005327 Unclassified 4578
7 Ga0070658_10327527 3300005327 Unclassified 1309
8 Ga0070683_100643151 3300005329 Bacteria 1015
9 Ga0070680_100037706 3300005336 Bacteria 3906
10 Ga0070680_100172889 3300005336 Bacteria 1818
11 Ga0070660_100028970 3300005339 Bacteria 4147
12 Ga0070671_101521048 3300005355 Bacteria 592
13 Ga0070659_100448437 3300005366 Unclassified 1094
14 Ga0070714_100009482 3300005435 Bacteria 7655
15 Ga0070681_10044168 3300005458 Bacteria 4460
16 Ga0070698_100298025 3300005471 Bacteria 1543
17 Ga0070679_100004929 3300005530 Bacteria 12317
18 Ga0070679_100221605 3300005530 Unclassified 1852
19 Ga0070679_101748211 3300005530 Unclassified 570
20 Ga0070684_100128309 3300005535 Unclassified 2286
21 Ga0068855_100001829 3300005563 Bacteria 26537
22 Ga0068855_100062031 3300005563 Bacteria 4366
23 Ga0068855_100080074 3300005563 Bacteria 3788
24 Ga0068855_100515643 3300005563 Unclassified 1298
25 Ga0068855_100736526 3300005563 Unclassified 1052
26 Ga0068857_100128556 3300005577 Bacteria 2284
27 Ga0068854_100219968 3300005578 Unclassified 1502
28 Ga0068856_100000001 3300005614 Bacteria 565602
29 Ga0068856_100003479 3300005614 Bacteria 15898
30 Ga0068856_100126433 3300005614 Unclassified 2560
31 Ga0068856_100966782 3300005614 Unclassified 870
32 Ga0068856_101194095 3300005614 Bacteria 777
33 Ga0068852_100031940 3300005616 Bacteria 4354
34 Ga0068863_101043129 3300005841 Bacteria 821
35 Ga0068863_102076409 3300005841 Unclassified 578
36 Ga0081455_10000003 3300005937 Bacteria 367763
37 Ga0070712_101254393 3300006175 Unclassified 645
38 Ga0075428_100787101 3300006844 Archaea 1011
39 Ga0105240_10053473 3300009093 Bacteria 5068
40 Ga0105240_10083518 3300009093 Unclassified 3919
41 Ga0105245_10045237 3300009098 Bacteria 3931
42 Ga0105241_10391046 3300009174 Bacteria 1217
43 Ga0157370_10550652 3300013104 Bacteria 1057
44 Ga0157369_10315355 3300013105 Unclassified 1626
45 Ga0157369_11829392 3300013105 Bacteria 617
46 Ga0157374_10042991 3300013296 Bacteria 4172
47 Ga0157372_10133912 3300013307 Unclassified 2853
48 Ga0157372_10846035 3300013307 Bacteria 1062
49 Ga0157372_11723484 3300013307 Bacteria 721
50 Ga0157372_13207009 3300013307 Unclassified 522
51 Ga0163163_10006016 3300014325 Bacteria 10556
52 Ga0157376_10000007 3300014969 Bacteria 368004
53 Ga0209674_100003 3300025226 Bacteria 2196646
54 Ga0209563_100010 3300025230 Bacteria 1337457
55 Ga0209677_100026 3300025253 Bacteria 382520
56 Ga0207705_10381225 3300025909 Bacteria 1089
57 Ga0207705_10391991 3300025909 Unclassified 1073
58 Ga0207654_11148909 3300025911 Bacteria 566
59 Ga0207695_10040483 3300025913 Bacteria 4995
60 Ga0207695_10124347 3300025913 Bacteria 2543
61 Ga0207660_10135542 3300025917 Bacteria 1878
62 Ga0207660_10228736 3300025917 Bacteria 1462
63 Ga0207657_10011787 3300025919 Bacteria 8657
64 Ga0207652_10003816 3300025921 Bacteria 12353
65 Ga0207652_10020315 3300025921 Bacteria 5467
66 Ga0207652_11853891 3300025921 Unclassified 508
67 Ga0207644_11378491 3300025931 Bacteria 592
68 Ga0207690_10365925 3300025932 Unclassified 1143
69 Ga0207661_10501992 3300025944 Bacteria 1108
70 Ga0207667_10065345 3300025949 Bacteria 3795
71 Ga0207667_10084363 3300025949 Unclassified 3289
72 Ga0207667_10182596 3300025949 Bacteria 2154
73 Ga0207667_10206867 3300025949 Bacteria 2012
74 Ga0207667_10686913 3300025949 Unclassified 1027
75 Ga0207667_11369145 3300025949 Bacteria 682
76 Ga0207702_10000001 3300026078 Bacteria 895738
77 Ga0207702_10003597 3300026078 Bacteria 14085
78 Ga0207702_10143816 3300026078 Unclassified 2161
79 Ga0207702_11131547 3300026078 Bacteria 777
80 Ga0207674_10319268 3300026116 Bacteria 1503
81 Ga0207698_10010118 3300026142 Bacteria 6041
82 Ga0265334_10077135 3300028573 Unclassified 1233
83 Ga0265338_10000066 3300028800 Bacteria 188576
84 Ga0265338_10282274 3300028800 Bacteria 1213
85 Ga0265338_10513587 3300028800 Bacteria 842
86 Ga0265338_10567976 3300028800 Bacteria 793
87 Ga0265327_10005209 3300031251 Bacteria 10976
88 Ga0373951_0031300 3300035091 Bacteria 1254
89 Ga0373953_0374159 3300035117 Unclassified 625
90 Ga0373954_0339187 3300035118 Unclassified 742
91 Ga0373935_0649124 3300035692 Unclassified 774
92 Ga0373947_0619055 3300035725 Unclassified 738
93 Ga0373947_0911020 3300035725 Unclassified 600
94 Ga0373925_0157203 3300037068 Bacteria 1789
95 Ga0395900_0002606 3300037418 Bacteria 19714
96 Ga0395900_0061978 3300037418 Bacteria 3845
97 Ga0395900_0363665 3300037418 Bacteria 1418
98 Ga0395898_1250353 3300037466 Unclassified 673
99 Ga0395905_0197048 3300037471 Unclassified 1889
100 Ga0395901_0001031 3300038443 Bacteria 30174
101 Ga0395901_0155958 3300038443 Unclassified 2398
102 Ga0395901_1192809 3300038443 Bacteria 727
103 Ga0451576_2306157 3300045051 Unclassified 552
104 Ga0496100_0230544 3300048903 Bacteria 1362
105 Ga0496112_0008437 3300048915 Bacteria 9228
106 Ga0496115_0001028 3300048918 Bacteria 20264
107 Ga0501033_0409204 3300049570 Bacteria 945
108 Ga0501034_0001886 3300049571 Bacteria 26544
109 Ga0501039_0991040 3300049575 Unclassified 653
110 Ga0501047_0000310 3300049581 Bacteria 56101
111 Ga0501048_0206912 3300049582 Unclassified 1392
112 Ga0501035_0000033 3300049822 Bacteria 175087
113 Ga0500616_0000830 3300053153 Bacteria 34848
114 Ga0070679_100667812
115 Ga0055539_1000267
116 Ga0055533_1000006
117 Ga0055525_1000601
118 Ga0065704_10257171
119 Ga0070658_10027344
120 Ga0070658_10327527
121 Ga0070683_100643151
122 Ga0070680_100037706
123 Ga0070680_100172889
124 Ga0070660_100028970
125 Ga0070671_101521048
126 Ga0070659_100448437
127 Ga0070714_100009482
128 Ga0070681_10044168
129 Ga0070698_100298025
130 Ga0070679_100004929
131 Ga0070679_100221605
132 Ga0070679_101748211
133 Ga0070684_100128309
134 Ga0068855_100001829
135 Ga0068855_100062031
136 Ga0068855_100080074
137 Ga0068855_100515643
138 Ga0068855_100736526
139 Ga0068857_100128556
140 Ga0068854_100219968
141 Ga0068856_100000001
142 Ga0068856_100003479
143 Ga0068856_100126433
144 Ga0068856_100966782
145 Ga0068856_101194095
146 Ga0068852_100031940
147 Ga0068863_101043129
148 Ga0068863_102076409
149 Ga0081455_10000003
150 Ga0070712_101254393
151 Ga0075428_100787101
152 Ga0105240_10053473
153 Ga0105240_10083518
154 Ga0105245_10045237
155 Ga0105241_10391046
156 Ga0157370_10550652
157 Ga0157369_10315355
158 Ga0157369_11829392
159 Ga0157374_10042991
160 Ga0157372_10133912
161 Ga0157372_10846035
162 Ga0157372_11723484
163 Ga0157372_13207009
164 Ga0163163_10006016
165 Ga0157376_10000007
166 Ga0209674_100003
167 Ga0209563_100010
168 Ga0209677_100026
169 Ga0207705_10381225
170 Ga0207705_10391991
171 Ga0207654_11148909
172 Ga0207695_10040483
173 Ga0207695_10124347
174 Ga0207660_10135542
175 Ga0207660_10228736
176 Ga0207657_10011787
177 Ga0207652_10003816
178 Ga0207652_10020315
179 Ga0207652_11853891
180 Ga0207644_11378491
181 Ga0207690_10365925
182 Ga0207661_10501992
183 Ga0207667_10065345
184 Ga0207667_10084363
185 Ga0207667_10182596
186 Ga0207667_10206867
187 Ga0207667_10686913
188 Ga0207667_11369145
189 Ga0207702_10000001
190 Ga0207702_10003597
191 Ga0207702_10143816
192 Ga0207702_11131547
193 Ga0207674_10319268
194 Ga0207698_10010118
195 Ga0265334_10077135
196 Ga0265338_10000066
197 Ga0265338_10282274
198 Ga0265338_10513587
199 Ga0265338_10567976
200 Ga0265327_10005209
201 Ga0373951_0031300
202 Ga0373953_0374159
203 Ga0373954_0339187
204 Ga0373935_0649124
205 Ga0373947_0619055
206 Ga0373947_0911020
207 Ga0373925_0157203
208 Ga0395900_0002606
209 Ga0395900_0061978
210 Ga0395900_0363665
211 Ga0395898_1250353
212 Ga0395905_0197048
213 Ga0395901_0001031
214 Ga0395901_0155958
215 Ga0395901_1192809
216 Ga0451576_2306157
217 Ga0496100_0230544
218 Ga0496112_0008437
219 Ga0496115_0001028
220 Ga0501033_0409204
221 Ga0501034_0001886
222 Ga0501039_0991040
223 Ga0501047_0000310
224 Ga0501048_0206912
225 Ga0501035_0000033
226 Ga0500616_0000830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

20

151

0.89

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

19

151

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8367 1 138
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8253 1 138
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.7686 2 137
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.7634 2 137
3l20-assembly1.cif.gz_B crystal structure of a hypothetical protein from staphylococcus aureus 0.7546 1 138
ID Description Score Start End Superfamily
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8648 83 137 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8205 8 138 3.10.180.10
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8087 8 138 3.10.180.10
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7877 8 140 3.10.180.10
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7855 83 137 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A142EMB0-F1-model_v4 PhnB-like domain-containing protein 0.9165 1 139
AF-A0A317GSI9-F1-model_v4 VOC family protein 0.9139 1 137
AF-A0A142EMB0-F1-model_v4 PhnB-like domain-containing protein 0.9042 1 139
AF-A0A7V4XRU3-F1-model_v4 VOC family protein 0.9038 1 140
AF-A0A317GSI9-F1-model_v4 VOC family protein 0.9014 1 137

Map