F071569

General Info

Members Datasets Scaffolds Average Seq Length
113 48 98 197

Family's Representative Sequence

Representative Sequence 2162886007|SwRhRL2b_contig_316639|SwRhRL2b_0578.00001300
Length 215
Sequence MGGLKPYNKQGLSMCEEIRFVVVSHHNRRDMGTRLADILGALLLVDEGDHGANWNHRRAIEWASQQDCRVVILEDDALPLPDFTQGVNEWLTKFPDNLISFYLGTGRPPQYQQHIAASLIDADRRRAAHITMDRLIHGVCYSPPVSGLSRIMQNWNRTKAADYAVGDALGGKVIYPCYSLVDHADGETVERHPDNQPRNERRRAWRLALFPVWNS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
3 2561511199 Enterobacter sp. R4-368 Isolate Nodule
4 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
5 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
6 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
7 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
8 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
9 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
10 2937539931 Pantoea sp. LS15 Isolate Unclassified
11 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
12 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
13 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
14 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
25 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
29 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
30 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
31 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
32 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
33 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
34 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
35 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
36 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
37 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
38 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
39 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
40 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
41 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
42 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
43 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
44 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
45 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
46 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
47 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
48 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.61
Metatranscriptomes 0
Isolates 12.39

Biome Distribution

Category Percentage (%)
Aerial Root 1.77
Bulb 0
Endosphere 0
Nodule 4.42
Rhizoplane 1.77
Rhizosphere 46.02
Stem 0
Stem Tuber 0
Unclassified 46.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_316639 2162886007 Bacteria 4375
2 Ga0058692_1001518 3300003856 Bacteria 8463
3 Ga0058692_1001525 3300003856 Bacteria 8427
4 Ga0065704_10096246 3300005289 Bacteria 2449
5 Ga0079104_1002246 3300006946 Bacteria 10777
6 Ga0105251_10003024 3300009011 Bacteria 12543
7 Ga0105251_10009414 3300009011 Bacteria 5771
8 Ga0105244_10000077 3300009036 Bacteria 110122
9 Ga0105244_10002770 3300009036 Bacteria 13072
10 Ga0105244_10002921 3300009036 Bacteria 12620
11 Ga0105244_10003246 3300009036 Bacteria 11746
12 Ga0105244_10007332 3300009036 Bacteria 7016
13 Ga0105250_10000245 3300009092 Bacteria 45183
14 Ga0105250_10000357 3300009092 Bacteria 34746
15 Ga0105250_10001035 3300009092 Bacteria 15943
16 Ga0105250_10005580 3300009092 Bacteria 5628
17 Ga0157373_10031917 3300013100 Bacteria 3793
18 Ga0157373_10044465 3300013100 Bacteria 3170
19 Ga0157371_10012998 3300013102 Viruses 6338
20 Ga0157369_10001677 3300013105 Bacteria 27017
21 Ga0163161_10009353 3300017792 Viruses 6781
22 Ga0207696_1000351 3300025711 Bacteria 47268
23 Ga0207696_1000555 3300025711 Bacteria 29784
24 Ga0207696_1000576 3300025711 Bacteria 28691
25 Ga0207655_1000177 3300025728 Bacteria 114493
26 Ga0207655_1001332 3300025728 Bacteria 23285
27 Ga0207655_1003499 3300025728 Bacteria 11648
28 Ga0207655_1020555 3300025728 Bacteria 3386
29 Ga0207713_1008184 3300025735 Bacteria 6051
30 Ga0207713_1010894 3300025735 Bacteria 4993
31 Ga0209281_1000123 3300027111 Bacteria 203957
32 Ga0209281_1000505 3300027111 Bacteria 51792
33 Ga0209371_1000624 3300027312 Bacteria 31486
34 Ga0209371_1001265 3300027312 Bacteria 17921
35 Ga0268256_1000570 3300030500 Bacteria 29730
36 Ga0268256_1001083 3300030500 Bacteria 17921
37 Ga0439438_004467 3300041405 Bacteria 5357
38 Ga0439438_015633 3300041405 Bacteria 2227
39 Ga0495617_067548 3300046452 Bacteria 1177
40 Ga0495625_0054081 3300046660 Bacteria 2868
41 Ga0495671_0000122 3300046692 Bacteria 70357
42 Ga0495649_0000256 3300046694 Bacteria 47374
43 Ga0495649_0000269 3300046694 Bacteria 46388
44 Ga0495649_0000529 3300046694 Bacteria 32452
45 Ga0495679_000051 3300047446 Bacteria 121243
46 Ga0495679_053956 3300047446 Bacteria 1199
47 Ga0496105_0012477 3300048908 Bacteria 6728
48 Ga0496105_0079391 3300048908 Bacteria 2710
49 Ga0496116_0000674 3300048919 Bacteria 44406
50 Ga0496116_0000675 3300048919 Bacteria 44328
51 Ga0496116_0000727 3300048919 Bacteria 42000
52 Ga0496116_0003249 3300048919 Bacteria 16189
53 Ga0496116_0034069 3300048919 Bacteria 3601
54 Ga0496117_0000164 3300048920 Bacteria 140349
55 Ga0496117_0001834 3300048920 Bacteria 28740
56 Ga0496117_0006095 3300048920 Bacteria 12348
57 Ga0496117_0008751 3300048920 Bacteria 9559
58 Ga0496117_0011845 3300048920 Bacteria 7761
59 Ga0496117_0012249 3300048920 Bacteria 7582
60 Ga0496117_0026792 3300048920 Bacteria 4503
61 Ga0496117_0028958 3300048920 Bacteria 4278
62 Ga0496117_0032768 3300048920 Bacteria 3941
63 Ga0496117_0172666 3300048920 Bacteria 1253
64 Ga0496118_0000474 3300048921 Bacteria 66564
65 Ga0496118_0001257 3300048921 Bacteria 38909
66 Ga0496118_0002024 3300048921 Bacteria 28654
67 Ga0496118_0002986 3300048921 Bacteria 21876
68 Ga0496118_0004594 3300048921 Bacteria 16234
69 Ga0496118_0007553 3300048921 Bacteria 11480
70 Ga0496118_0022055 3300048921 Bacteria 5582
71 Ga0496119_0000106 3300048922 Bacteria 116871
72 Ga0496119_0000461 3300048922 Bacteria 55643
73 Ga0496119_0000782 3300048922 Bacteria 42502
74 Ga0496119_0001185 3300048922 Bacteria 32670
75 Ga0496119_0012294 3300048922 Bacteria 6973
76 Ga0496120_0000290 3300048923 Bacteria 84735
77 Ga0496120_0000669 3300048923 Bacteria 50381
78 Ga0496120_0000715 3300048923 Bacteria 48692
79 Ga0496120_0004155 3300048923 Bacteria 12441
80 Ga0496120_0056295 3300048923 Bacteria 2220
81 Ga0496121_0440225 3300048924 Bacteria 843
82 Ga0496122_0002691 3300048925 Viruses 24722
83 Ga0496122_0002695 3300048925 Bacteria 24701
84 Ga0496122_0102465 3300048925 Bacteria 1908
85 Ga0496122_0370005 3300048925 Bacteria 740
86 Ga0496123_0000134 3300048926 Bacteria 153219
87 Ga0496123_0159336 3300048926 Bacteria 1205
88 Ga0496123_0160481 3300048926 Bacteria 1199
89 Ga0496124_0000896 3300048927 Bacteria 48151
90 Ga0496124_0003524 3300048927 Bacteria 19064
91 Ga0496125_0001196 3300048928 Bacteria 39073
92 Ga0496125_0001806 3300048928 Bacteria 29548
93 Ga0496125_0001833 3300048928 Bacteria 29355
94 Ga0496125_0004162 3300048928 Viruses 16866
95 Ga0496125_0024483 3300048928 Bacteria 5550
96 Ga0496126_0001631 3300048929 Bacteria 33932
97 Ga0496126_0105927 3300048929 Bacteria 2454
98 Ga0496126_0555192 3300048929 Bacteria 911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0000675 Ga0496116_0000675_18463_18957 164
2 3300048927 Ga0496124_0003524 Ga0496124_0003524_16201_16695 164
3 3300048928 Ga0496125_0001806 Ga0496125_0001806_24897_25391 164
4 iso_pu_bacteria 2888373701 2888373968 173
5 3300048920 Ga0496117_0172666 Ga0496117_0172666_329_874 181
6 3300048922 Ga0496119_0012294 Ga0496119_0012294_4698_5255 185
7 3300048923 Ga0496120_0004155 Ga0496120_0004155_4652_5209 185
8 3300046660 Ga0495625_0054081 Ga0495625_0054081_22_600 187
9 3300048919 Ga0496116_0003249 Ga0496116_0003249_12535_13104 187
10 3300048920 Ga0496117_0026792 Ga0496117_0026792_2980_3549 187
11 3300048921 Ga0496118_0004594 Ga0496118_0004594_12718_13287 187
12 iso_pu_bacteria 2927833300 2927835136 191
13 iso_pu_bacteria 2937539931 2937543149 191
14 iso_pu_bacteria 2939602548 2939606065 191
15 3300048920 Ga0496117_0000164 Ga0496117_0000164_42098_42676 192
16 3300048921 Ga0496118_0000474 Ga0496118_0000474_37301_37879 192
17 iso_pu_bacteria 2511231035 2511434426 192
18 iso_pu_bacteria 2923634449 2923635804 192
19 iso_pu_bacteria 2927833300 2927837696 192
20 iso_pu_bacteria 2561511199 2562463509 193
21 3300046692 Ga0495671_0000122 Ga0495671_0000122_24068_24670 194
22 3300048920 Ga0496117_0008751 Ga0496117_0008751_8391_8975 194
23 3300048920 Ga0496117_0028958 Ga0496117_0028958_3006_3590 194
24 3300048921 Ga0496118_0002986 Ga0496118_0002986_2432_3016 194
25 3300003856 Ga0058692_1001518 Ga0058692_10015186 195
26 3300003856 Ga0058692_1001525 Ga0058692_10015253 195
27 3300009011 Ga0105251_10003024 Ga0105251_1000302415 195
28 3300009036 Ga0105244_10003246 Ga0105244_100032465 195
29 3300013100 Ga0157373_10044465 Ga0157373_100444652 195
30 3300013102 Ga0157371_10012998 Ga0157371_100129986 195
31 3300013105 Ga0157369_10001677 Ga0157369_100016776 195
32 3300017792 Ga0163161_10009353 Ga0163161_100093534 195
33 3300025735 Ga0207713_1008184 Ga0207713_10081845 195
34 3300027312 Ga0209371_1000624 Ga0209371_100062420 195
35 3300027312 Ga0209371_1001265 Ga0209371_100126512 195
36 3300030500 Ga0268256_1000570 Ga0268256_100057017 195
37 3300030500 Ga0268256_1001083 Ga0268256_100108317 195
38 3300046452 Ga0495617_067548 Ga0495617_067548_154_744 195
39 3300048919 Ga0496116_0000674 Ga0496116_0000674_19344_19931 195
40 3300048920 Ga0496117_0001834 Ga0496117_0001834_22481_23068 195
41 3300048920 Ga0496117_0006095 Ga0496117_0006095_2500_3087 195
42 3300048920 Ga0496117_0012249 Ga0496117_0012249_6650_7237 195
43 3300048920 Ga0496117_0032768 Ga0496117_0032768_346_933 195
44 3300048921 Ga0496118_0001257 Ga0496118_0001257_15291_15878 195
45 3300048921 Ga0496118_0002024 Ga0496118_0002024_4626_5213 195
46 3300048921 Ga0496118_0022055 Ga0496118_0022055_645_1232 195
47 3300048928 Ga0496125_0001196 Ga0496125_0001196_16381_16968 195
48 3300048929 Ga0496126_0105927 Ga0496126_0105927_1798_2385 195
49 3300006946 Ga0079104_1002246 Ga0079104_10022466 196
50 3300009036 Ga0105244_10002770 Ga0105244_1000277023 196
51 3300009092 Ga0105250_10000245 Ga0105250_1000024532 196
52 3300009092 Ga0105250_10000357 Ga0105250_1000035723 196
53 3300025711 Ga0207696_1000351 Ga0207696_100035134 196
54 3300025711 Ga0207696_1000576 Ga0207696_100057615 196
55 3300025728 Ga0207655_1020555 Ga0207655_10205556 196
56 3300027111 Ga0209281_1000505 Ga0209281_100050541 196
57 3300048919 Ga0496116_0000727 Ga0496116_0000727_18307_18897 196
58 3300048922 Ga0496119_0000461 Ga0496119_0000461_21105_21695 196
59 3300048923 Ga0496120_0000290 Ga0496120_0000290_33949_34539 196
60 3300048924 Ga0496121_0440225 Ga0496121_0440225_172_762 196
61 3300048925 Ga0496122_0002695 Ga0496122_0002695_3311_3904 196
62 3300048925 Ga0496122_0102465 Ga0496122_0102465_1261_1851 196
63 3300048925 Ga0496122_0370005 Ga0496122_0370005_128_718 196
64 3300048926 Ga0496123_0159336 Ga0496123_0159336_252_842 196
65 3300048927 Ga0496124_0000896 Ga0496124_0000896_24610_25200 196
66 3300048928 Ga0496125_0001833 Ga0496125_0001833_21012_21605 196
67 3300048929 Ga0496126_0555192 Ga0496126_0555192_122_712 196
68 3300027111 Ga0209281_1000123 Ga0209281_1000123104 197
69 3300027111 Ga0209281_1000123 Ga0209281_1000123166 197
70 3300041405 Ga0439438_004467 Ga0439438_004467_2762_3355 197
71 3300041405 Ga0439438_015633 Ga0439438_015633_666_1259 197
72 3300046694 Ga0495649_0000269 Ga0495649_0000269_26183_26776 197
73 3300048925 Ga0496122_0002691 Ga0496122_0002691_19062_19655 197
74 3300048926 Ga0496123_0000134 Ga0496123_0000134_36506_37099 197
75 iso_pu_bacteria 2648501693 2650897889 197
76 iso_pu_bacteria 2881609920 2881613016 198
77 iso_pu_bacteria 2978975091 2978979164 198
78 iso_pu_bacteria 2984494565 2984497305 198
79 iso_pu_bacteria 2990261002 2990261256 198
80 3300048920 Ga0496117_0011845 Ga0496117_0011845_62_661 199
81 3300048921 Ga0496118_0007553 Ga0496118_0007553_7549_8148 199
82 3300048922 Ga0496119_0000782 Ga0496119_0000782_16819_17418 199
83 3300048923 Ga0496120_0000669 Ga0496120_0000669_24698_25297 199
84 3300048926 Ga0496123_0160481 Ga0496123_0160481_455_1054 199
85 3300048928 Ga0496125_0004162 Ga0496125_0004162_5259_5858 199
86 3300048928 Ga0496125_0024483 Ga0496125_0024483_591_1190 199
87 iso_pu_bacteria 2808606414 2809127922 199
88 3300009036 Ga0105244_10000077 Ga0105244_1000007757 201
89 3300025728 Ga0207655_1000177 Ga0207655_100017771 201
90 3300005289 Ga0065704_10096246 Ga0065704_100962463 202
91 3300009011 Ga0105251_10009414 Ga0105251_100094146 202
92 3300009036 Ga0105244_10002921 Ga0105244_1000292114 202
93 3300009036 Ga0105244_10007332 Ga0105244_100073325 202
94 3300009092 Ga0105250_10001035 Ga0105250_1000103512 202
95 3300009092 Ga0105250_10005580 Ga0105250_100055806 202
96 3300013100 Ga0157373_10031917 Ga0157373_100319174 202
97 3300025711 Ga0207696_1000555 Ga0207696_100055517 202
98 3300025728 Ga0207655_1001332 Ga0207655_10013327 202
99 3300025728 Ga0207655_1003499 Ga0207655_100349913 202
100 3300025735 Ga0207713_1010894 Ga0207713_10108945 202
101 3300047446 Ga0495679_000051 Ga0495679_000051_77206_77823 202
102 3300048908 Ga0496105_0012477 Ga0496105_0012477_3080_3721 202
103 3300048908 Ga0496105_0079391 Ga0496105_0079391_1695_2333 202
104 3300048919 Ga0496116_0034069 Ga0496116_0034069_1667_2281 202
105 3300048922 Ga0496119_0000106 Ga0496119_0000106_90198_90839 202
106 3300048923 Ga0496120_0000715 Ga0496120_0000715_26033_26674 202
107 3300046694 Ga0495649_0000256 Ga0495649_0000256_23132_23746 203
108 3300046694 Ga0495649_0000529 Ga0495649_0000529_4888_5502 203
109 3300047446 Ga0495679_053956 Ga0495679_053956_436_1050 203
110 3300048922 Ga0496119_0001185 Ga0496119_0001185_9471_10088 205
111 3300048923 Ga0496120_0056295 Ga0496120_0056295_230_847 205
112 3300048929 Ga0496126_0001631 Ga0496126_0001631_8485_9102 205
113 2162886007 SwRhRL2b_contig_316639 SwRhRL2b_0578.00001300 215

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cu2-assembly1.cif.gz_A c-terminal domain of ctp1l endolysin mutant v195p that reduces autoproteolysis 0.8435 19 45
5a6s-assembly1.cif.gz_B-2 crystal structure of the ctp1l endolysin reveals how its activity is regulated by a secondary translation product 0.7665 19 49
6y30-assembly1.cif.gz_A ng domain of human srp54 t115a mutant 0.691 18 74
3x43-assembly2.cif.gz_H crystal structure of o-ureido-l-serine synthase 0.6785 19 65
3lma-assembly2.cif.gz_C crystal structure of the stage v sporulation protein ad (spovad) from bacillus licheniformis. northeast structural genomics consortium target bir6. 0.65 19 74
ID Description Score Start End Superfamily
1dkuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7997 20 49 3.40.50.2020
5a6sB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7666 19 49 3.40.50.12090
af_Q23166_156_323_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7206 20 53 3.40.50.2020
af_Q55EK3_134_353_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.6829 20 186 3.90.550.10
af_Q2G0S2_154_297_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6786 9 45 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A2S5KEE2-F1-model_v4 Uncharacterized protein 0.9951 17 209
AF-C9XYH9-F1-model_v4 Glycosyltransferase 0.9919 19 209
AF-A0A2S5KEE2-F1-model_v4 Uncharacterized protein 0.9849 17 209
AF-E0LUZ1-F1-model_v4 Glycosyltransferase 0.9839 17 215
AF-C9XYH9-F1-model_v4 Glycosyltransferase 0.9817 19 209

Feature Viewer

pLDDT pTM Quality
85.66 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map