F068663

General Info

Members Datasets Scaffolds Average Seq Length
112 91 224 232

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10049912|Ga0099794_100499123
Length 262
Sequence VSILFPLMKPSLALVPALMIRAVTVPDAGILVLYVEDDDRLSQLTAKYLESHGVRVVVVPNGLEAVGQAVRLRPDVVLLDLMLPGIDGLEVCRRLRSRLDTPVLMVTAHGDEPDRVVGLEGGADDYIVKPFSSRELLARIRAQARRARGRAGPPGQAVVVGALRIEPQAMQATLAGRPIQLTTYEFALLRALAHRAGHVLSREQLIDLVRGSAEEAFDRSIDVHVSHLRQKLGDDPRNPRLLKTVRGVGYMLACADASSFDT

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
51 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
52 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
57 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
58 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
64 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
65 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
66 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
67 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
73 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
74 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
75 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
80 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
83 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
85 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
86 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
87 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
90 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
91 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.57
Nodule 0
Rhizoplane 1.79
Rhizosphere 88.39
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10049912 3300007265 Bacteria 2012
2 rootH2_10050999 3300003320 Bacteria 14286
3 Ga0070658_10630011 3300005327 Bacteria 930
4 Ga0068868_100026688 3300005338 Bacteria 4404
5 Ga0070689_100009474 3300005340 Bacteria 6904
6 Ga0070700_100263415 3300005441 Bacteria 1242
7 Ga0070708_100002529 3300005445 Bacteria 14122
8 Ga0070708_100111054 3300005445 Bacteria 2520
9 Ga0070706_100000099 3300005467 Bacteria 105782
10 Ga0070706_100050671 3300005467 Bacteria 3831
11 Ga0070707_100002199 3300005468 Bacteria 18624
12 Ga0070707_100005116 3300005468 Bacteria 12296
13 Ga0070698_100008637 3300005471 Bacteria 10977
14 Ga0070699_100002724 3300005518 Bacteria 15761
15 Ga0070699_100256563 3300005518 Bacteria 1563
16 Ga0070684_100805756 3300005535 Bacteria 878
17 Ga0070697_100001892 3300005536 Bacteria 16001
18 Ga0070697_100005126 3300005536 Bacteria 10063
19 Ga0070686_100168276 3300005544 Bacteria 1548
20 Ga0070696_100139214 3300005546 Bacteria 1772
21 Ga0068855_100000025 3300005563 Bacteria 178174
22 Ga0068856_100336411 3300005614 Bacteria 1528
23 Ga0068858_100794506 3300005842 Bacteria 923
24 Ga0068860_100002629 3300005843 Bacteria 18678
25 Ga0075366_10083184 3300006195 Bacteria 1913
26 Ga0075366_10134779 3300006195 Bacteria 1491
27 Ga0068871_100177339 3300006358 Bacteria 1830
28 Ga0075428_100176583 3300006844 Bacteria 2313
29 Ga0075428_100194924 3300006844 Bacteria 2191
30 Ga0075430_100023372 3300006846 Bacteria 5261
31 Ga0075430_100332532 3300006846 Bacteria 1255
32 Ga0075431_100350626 3300006847 Bacteria 1484
33 Ga0075435_100187444 3300007076 Bacteria 1750
34 Ga0111539_10003940 3300009094 Bacteria 19515
35 Ga0105245_10000710 3300009098 Bacteria 29958
36 Ga0105247_10005029 3300009101 Bacteria 8394
37 Ga0114129_10833554 3300009147 Bacteria 1174
38 Ga0105241_10037854 3300009174 Bacteria 3635
39 Ga0105237_10966728 3300009545 Bacteria 858
40 Ga0105249_10213481 3300009553 Bacteria 1895
41 Ga0157380_10079482 3300014326 Bacteria 2678
42 Ga0207710_10091434 3300025900 Bacteria 1425
43 Ga0207699_10172957 3300025906 Bacteria 1446
44 Ga0207684_10000047 3300025910 Bacteria 244386
45 Ga0207684_10040852 3300025910 Bacteria 3932
46 Ga0207707_10304066 3300025912 Bacteria 1379
47 Ga0207662_10020365 3300025918 Bacteria 3784
48 Ga0207646_10016576 3300025922 Bacteria 6913
49 Ga0207687_10004727 3300025927 Bacteria 9060
50 Ga0207687_10057599 3300025927 Bacteria 2730
51 Ga0207670_10008484 3300025936 Bacteria 5806
52 Ga0207670_10088342 3300025936 Bacteria 2186
53 Ga0207667_10000089 3300025949 Bacteria 149275
54 Ga0207677_10079937 3300026023 Bacteria 2340
55 Ga0207703_10707118 3300026035 Bacteria 958
56 Ga0207648_10042673 3300026089 Bacteria 3982
57 Ga0207428_10092738 3300027907 Bacteria 2343
58 Ga0268264_10002144 3300028381 Bacteria 17611
59 Ga0268264_10763773 3300028381 Bacteria 964
60 Ga0265318_10001848 3300028577 Bacteria 11965
61 Ga0265338_10133640 3300028800 Bacteria 1954
62 Ga0265330_10002054 3300031235 Bacteria 11144
63 Ga0265332_10001335 3300031238 Bacteria 13975
64 Ga0265332_10010671 3300031238 Bacteria 4087
65 Ga0265328_10000972 3300031239 Bacteria 13146
66 Ga0265320_10000221 3300031240 Bacteria 46329
67 Ga0265331_10000378 3300031250 Bacteria 46319
68 Ga0307513_10319000 3300031456 Unclassified 1313
69 Ga0265313_10000196 3300031595 Bacteria 64798
70 Ga0307508_10226182 3300031616 Bacteria 1470
71 Ga0307514_10150809 3300031649 Bacteria 1560
72 Ga0265314_10000555 3300031711 Bacteria 47583
73 Ga0265342_10001453 3300031712 Bacteria 22060
74 Ga0307406_10020723 3300031901 Bacteria 3877
75 Ga0307406_10281091 3300031901 Bacteria 1269
76 Ga0307409_100805806 3300031995 Bacteria 947
77 Ga0307409_100823965 3300031995 Bacteria 937
78 Ga0307507_10032745 3300033179 Bacteria 5417
79 Ga0307507_10217365 3300033179 Bacteria 1291
80 Ga0373934_0102900 3300035086 Bacteria 1155
81 Ga0373956_0006705 3300035119 Bacteria 4620
82 Ga0373955_0322458 3300035172 Bacteria 933
83 Ga0373931_0320330 3300035691 Bacteria 963
84 Ga0373927_0020021 3300035695 Bacteria 4388
85 Ga0373937_0202925 3300036401 Bacteria 1864
86 Ga0373937_0628844 3300036401 Bacteria 1019
87 Ga0395905_0046491 3300037471 Bacteria 4070
88 Ga0436365_1752235 3300039437 Bacteria 1202
89 Ga0451807_1545246 3300041486 Bacteria 1246
90 Ga0439445_0041736 3300042004 Bacteria 1220
91 Ga0450898_015263 3300042134 Bacteria 1300
92 Ga0466969_0079276 3300044656 Bacteria 1570
93 Ga0451576_0650842 3300045051 Bacteria 1107
94 Ga0451576_0766450 3300045051 Bacteria 1013
95 Ga0495629_0068751 3300046459 Bacteria 2472
96 Ga0495638_0132494 3300046460 Bacteria 1463
97 Ga0495594_0109097 3300046499 Bacteria 1560
98 Ga0495636_0023030 3300047318 Bacteria 2519
99 Ga0495636_0102106 3300047318 Bacteria 1255
100 Ga0495680_0073777 3300047322 Bacteria 2592
101 Ga0496109_0600353 3300048912 Bacteria 1037
102 Ga0501042_0224260 3300049578 Bacteria 1356
103 Ga0501083_0015514 3300049744 Bacteria 5335
104 Ga0501083_0343327 3300049744 Bacteria 971
105 Ga0501035_0003017 3300049822 Bacteria 16150
106 nmdc:mga0k408_94117_c1 3300050493 Bacteria 1762
107 nmdc:mga0qj67_130887_c1 3300050509 Bacteria 2032
108 nmdc:mga0qj67_301479_c1 3300050509 Bacteria 1298
109 nmdc:mga06r32_73039_c1 3300050510 Bacteria 3322
110 nmdc:mga08y16_67996_c1 3300050511 Bacteria 3716
111 nmdc:mga08x19_81404_c1 3300050514 Bacteria 2126
112 Ga0500642_0182838 3300053130 Bacteria 979
113 Ga0099794_10049912
114 rootH2_10050999
115 Ga0070658_10630011
116 Ga0068868_100026688
117 Ga0070689_100009474
118 Ga0070700_100263415
119 Ga0070708_100002529
120 Ga0070708_100111054
121 Ga0070706_100000099
122 Ga0070706_100050671
123 Ga0070707_100002199
124 Ga0070707_100005116
125 Ga0070698_100008637
126 Ga0070699_100002724
127 Ga0070699_100256563
128 Ga0070684_100805756
129 Ga0070697_100001892
130 Ga0070697_100005126
131 Ga0070686_100168276
132 Ga0070696_100139214
133 Ga0068855_100000025
134 Ga0068856_100336411
135 Ga0068858_100794506
136 Ga0068860_100002629
137 Ga0075366_10083184
138 Ga0075366_10134779
139 Ga0068871_100177339
140 Ga0075428_100176583
141 Ga0075428_100194924
142 Ga0075430_100023372
143 Ga0075430_100332532
144 Ga0075431_100350626
145 Ga0075435_100187444
146 Ga0111539_10003940
147 Ga0105245_10000710
148 Ga0105247_10005029
149 Ga0114129_10833554
150 Ga0105241_10037854
151 Ga0105237_10966728
152 Ga0105249_10213481
153 Ga0157380_10079482
154 Ga0207710_10091434
155 Ga0207699_10172957
156 Ga0207684_10000047
157 Ga0207684_10040852
158 Ga0207707_10304066
159 Ga0207662_10020365
160 Ga0207646_10016576
161 Ga0207687_10004727
162 Ga0207687_10057599
163 Ga0207670_10008484
164 Ga0207670_10088342
165 Ga0207667_10000089
166 Ga0207677_10079937
167 Ga0207703_10707118
168 Ga0207648_10042673
169 Ga0207428_10092738
170 Ga0268264_10002144
171 Ga0268264_10763773
172 Ga0265318_10001848
173 Ga0265338_10133640
174 Ga0265330_10002054
175 Ga0265332_10001335
176 Ga0265332_10010671
177 Ga0265328_10000972
178 Ga0265320_10000221
179 Ga0265331_10000378
180 Ga0307513_10319000
181 Ga0265313_10000196
182 Ga0307508_10226182
183 Ga0307514_10150809
184 Ga0265314_10000555
185 Ga0265342_10001453
186 Ga0307406_10020723
187 Ga0307406_10281091
188 Ga0307409_100805806
189 Ga0307409_100823965
190 Ga0307507_10032745
191 Ga0307507_10217365
192 Ga0373934_0102900
193 Ga0373956_0006705
194 Ga0373955_0322458
195 Ga0373931_0320330
196 Ga0373927_0020021
197 Ga0373937_0202925
198 Ga0373937_0628844
199 Ga0395905_0046491
200 Ga0436365_1752235
201 Ga0451807_1545246
202 Ga0439445_0041736
203 Ga0450898_015263
204 Ga0466969_0079276
205 Ga0451576_0650842
206 Ga0451576_0766450
207 Ga0495629_0068751
208 Ga0495638_0132494
209 Ga0495594_0109097
210 Ga0495636_0023030
211 Ga0495636_0102106
212 Ga0495680_0073777
213 Ga0496109_0600353
214 Ga0501042_0224260
215 Ga0501083_0015514
216 Ga0501083_0343327
217 Ga0501035_0003017
218 nmdc:mga0k408_94117_c1
219 nmdc:mga0qj67_130887_c1
220 nmdc:mga0qj67_301479_c1
221 nmdc:mga06r32_73039_c1
222 nmdc:mga08y16_67996_c1
223 nmdc:mga08x19_81404_c1
224 Ga0500642_0182838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

32

141

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

176

252

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9805 11 126
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9772 11 126
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9753 10 128
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9752 10 128
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9742 10 127
ID Description Score Start End Superfamily
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9813 10 88 3.40.50.2300
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9785 8 127 3.40.50.2300
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9728 11 127 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9707 11 85 3.40.50.2300
af_P23836_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9659 10 88 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3D1Q0L7-F1-model_v4 deleted 0.8798 6 147
AF-A0A3D1Q0L7-F1-model_v4 deleted 0.8346 6 147
AF-A0A100HXK1-F1-model_v4 deleted 0.8279 5 236
AF-A0A292EE03-F1-model_v4 DNA-binding response regulator 0.8262 3 234 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-V7I6Q9-F1-model_v4 Stage 0 sporulation protein A homolog 0.8114 8 237 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map