F058847

General Info

Members Datasets Scaffolds Average Seq Length
110 84 220 102

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10337635|Ga0111539_103376352
Length 118
Sequence MRPFGCVHAGRRVAFAAVRPADIQQIGNELAIKWDDGTESFVALEKLRRACPCAGCKGEMDIMGNVYRGPEKPLRPESYQLLRLAHVGGYALQPHWADGHSSGLYSFDYLRRVADEAS

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
73 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
74 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
75 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
76 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
80 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
81 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
82 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
83 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
84 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.91
Rhizosphere 99.09
Stem 0
Stem Tuber 0
Unclassified 43.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10337635 3300009094 Bacteria 1754
2 CNXas_1000243 3300000545 Bacteria 6532
3 Ga0070676_10418853 3300005328 Bacteria 935
4 Ga0070690_101095120 3300005330 Unclassified 632
5 Ga0070677_10248106 3300005333 Bacteria 882
6 Ga0070677_10331651 3300005333 Unclassified 782
7 Ga0068868_100661515 3300005338 Bacteria 931
8 Ga0070689_100006478 3300005340 Bacteria 8107
9 Ga0070689_100091108 3300005340 Bacteria 2403
10 Ga0070691_10303084 3300005341 Unclassified 873
11 Ga0070687_100071324 3300005343 Bacteria 1866
12 Ga0070687_100140594 3300005343 Unclassified 1405
13 Ga0070687_100440456 3300005343 Unclassified 864
14 Ga0070675_100109563 3300005354 Bacteria 2334
15 Ga0070671_100221007 3300005355 Unclassified 1607
16 Ga0070688_100047737 3300005365 Bacteria 2658
17 Ga0070688_100132587 3300005365 Bacteria 1683
18 Ga0070688_100654102 3300005365 Unclassified 810
19 Ga0070667_101002290 3300005367 Bacteria 779
20 Ga0070711_100114202 3300005439 Bacteria 1987
21 Ga0070694_101254485 3300005444 Unclassified 622
22 Ga0070708_100642966 3300005445 Bacteria 1000
23 Ga0070685_10305747 3300005466 Unclassified 1073
24 Ga0070685_11044446 3300005466 Unclassified 615
25 Ga0070706_100084295 3300005467 Unclassified 2945
26 Ga0070706_100407006 3300005467 Unclassified 1267
27 Ga0070698_101032059 3300005471 Unclassified 770
28 Ga0070696_100307954 3300005546 Unclassified 1215
29 Ga0068855_100501614 3300005563 Unclassified 1319
30 Ga0068857_100120161 3300005577 Bacteria 2365
31 Ga0070702_100211177 3300005615 Bacteria 1292
32 Ga0070702_100534965 3300005615 Unclassified 867
33 Ga0068859_100877894 3300005617 Bacteria 982
34 Ga0068858_101013171 3300005842 Bacteria 814
35 Ga0068858_101132839 3300005842 Bacteria 768
36 Ga0068860_102689119 3300005843 Unclassified 516
37 Ga0070712_100407478 3300006175 Unclassified 1124
38 Ga0070712_101755071 3300006175 Unclassified 543
39 Ga0097621_100208009 3300006237 Bacteria 1701
40 Ga0068871_102082745 3300006358 Unclassified 540
41 Ga0075428_100436331 3300006844 Bacteria 1403
42 Ga0075436_100679752 3300006914 Bacteria 762
43 Ga0097620_100878121 3300006931 Bacteria 982
44 Ga0105240_12496486 3300009093 Bacteria 534
45 Ga0111539_10087881 3300009094 Bacteria 3651
46 Ga0111539_10184062 3300009094 Bacteria 2440
47 Ga0111539_10429309 3300009094 Bacteria 1539
48 Ga0111539_12344588 3300009094 Bacteria 619
49 Ga0105245_10296798 3300009098 Bacteria 1584
50 Ga0105248_11050813 3300009177 Bacteria 920
51 Ga0105237_10827456 3300009545 Unclassified 933
52 Ga0105249_11426647 3300009553 Bacteria 764
53 Ga0157374_10312922 3300013296 Bacteria 1555
54 Ga0163162_13425884 3300013306 Unclassified 506
55 Ga0157372_10458318 3300013307 Bacteria 1486
56 Ga0163163_10265190 3300014325 Bacteria 1769
57 Ga0163163_10381520 3300014325 Bacteria 1467
58 Ga0157380_10358536 3300014326 Bacteria 1367
59 Ga0157379_10401546 3300014968 Bacteria 1260
60 Ga0157376_10249587 3300014969 Bacteria 1657
61 Ga0157376_11767898 3300014969 Bacteria 654
62 Ga0207699_11059454 3300025906 Unclassified 600
63 Ga0207684_10693022 3300025910 Unclassified 866
64 Ga0207662_10165064 3300025918 Unclassified 1417
65 Ga0207662_10271645 3300025918 Unclassified 1119
66 Ga0207659_10488143 3300025926 Bacteria 1041
67 Ga0207686_10094580 3300025934 Bacteria 1981
68 Ga0207670_10001729 3300025936 Bacteria 11401
69 Ga0207711_10923432 3300025941 Bacteria 811
70 Ga0207667_10419495 3300025949 Unclassified 1362
71 Ga0207703_11148228 3300026035 Bacteria 746
72 Ga0207683_11368975 3300026121 Unclassified 654
73 Ga0265338_10000041 3300028800 Bacteria 230676
74 Ga0265338_10001858 3300028800 Bacteria 33162
75 Ga0265338_10184485 3300028800 Bacteria 1587
76 Ga0265338_10225916 3300028800 Bacteria 1395
77 Ga0265320_10332835 3300031240 Unclassified 671
78 Ga0265327_10005650 3300031251 Bacteria 10351
79 Ga0265327_10022763 3300031251 Bacteria 3733
80 Ga0265327_10171692 3300031251 Bacteria 996
81 Ga0265316_10658829 3300031344 Unclassified 740
82 Ga0265316_10723570 3300031344 Unclassified 701
83 Ga0265316_10728792 3300031344 Unclassified 698
84 Ga0307408_101620231 3300031548 Unclassified 615
85 Ga0265314_10079130 3300031711 Bacteria 2174
86 Ga0307410_10358087 3300031852 Unclassified 1168
87 Ga0307416_100455591 3300032002 Bacteria 1333
88 Ga0307411_10733179 3300032005 Unclassified 864
89 Ga0307415_100182846 3300032126 Bacteria 1647
90 Ga0373943_0050266 3300035170 Unclassified 2048
91 Ga0373931_0142200 3300035691 Bacteria 1391
92 Ga0373947_0084612 3300035725 Unclassified 1969
93 Ga0373925_1727220 3300037068 Unclassified 511
94 Ga0395905_0450723 3300037471 Unclassified 1185
95 Ga0453684_0004390 3300044712 Bacteria 29850
96 Ga0451576_0123582 3300045051 Unclassified 2696
97 Ga0495630_0223794 3300046517 Unclassified 1437
98 Ga0495634_0730856 3300046642 Unclassified 568
99 Ga0495658_0001303 3300046683 Bacteria 13074
100 Ga0495658_0681180 3300046683 Unclassified 659
101 Ga0496115_0018729 3300048918 Bacteria 5322
102 Ga0501034_0066027 3300049571 Bacteria 3632
103 Ga0501036_0789191 3300049572 Unclassified 782
104 Ga0501043_0204465 3300049579 Unclassified 1531
105 Ga0501233_164356 3300049668 Unclassified 627
106 Ga0501257_021587 3300049686 Bacteria 1519
107 Ga0501083_0259815 3300049744 Unclassified 1130
108 nmdc:mga08y16_394360_c1 3300050511 Bacteria 1417
109 nmdc:mga0n895_331369_c1 3300050512 Bacteria 1542
110 Ga0590075_175163 3300059424 Unclassified 567
111 Ga0111539_10337635
112 CNXas_1000243
113 Ga0070676_10418853
114 Ga0070690_101095120
115 Ga0070677_10248106
116 Ga0070677_10331651
117 Ga0068868_100661515
118 Ga0070689_100006478
119 Ga0070689_100091108
120 Ga0070691_10303084
121 Ga0070687_100071324
122 Ga0070687_100140594
123 Ga0070687_100440456
124 Ga0070675_100109563
125 Ga0070671_100221007
126 Ga0070688_100047737
127 Ga0070688_100132587
128 Ga0070688_100654102
129 Ga0070667_101002290
130 Ga0070711_100114202
131 Ga0070694_101254485
132 Ga0070708_100642966
133 Ga0070685_10305747
134 Ga0070685_11044446
135 Ga0070706_100084295
136 Ga0070706_100407006
137 Ga0070698_101032059
138 Ga0070696_100307954
139 Ga0068855_100501614
140 Ga0068857_100120161
141 Ga0070702_100211177
142 Ga0070702_100534965
143 Ga0068859_100877894
144 Ga0068858_101013171
145 Ga0068858_101132839
146 Ga0068860_102689119
147 Ga0070712_100407478
148 Ga0070712_101755071
149 Ga0097621_100208009
150 Ga0068871_102082745
151 Ga0075428_100436331
152 Ga0075436_100679752
153 Ga0097620_100878121
154 Ga0105240_12496486
155 Ga0111539_10087881
156 Ga0111539_10184062
157 Ga0111539_10429309
158 Ga0111539_12344588
159 Ga0105245_10296798
160 Ga0105248_11050813
161 Ga0105237_10827456
162 Ga0105249_11426647
163 Ga0157374_10312922
164 Ga0163162_13425884
165 Ga0157372_10458318
166 Ga0163163_10265190
167 Ga0163163_10381520
168 Ga0157380_10358536
169 Ga0157379_10401546
170 Ga0157376_10249587
171 Ga0157376_11767898
172 Ga0207699_11059454
173 Ga0207684_10693022
174 Ga0207662_10165064
175 Ga0207662_10271645
176 Ga0207659_10488143
177 Ga0207686_10094580
178 Ga0207670_10001729
179 Ga0207711_10923432
180 Ga0207667_10419495
181 Ga0207703_11148228
182 Ga0207683_11368975
183 Ga0265338_10000041
184 Ga0265338_10001858
185 Ga0265338_10184485
186 Ga0265338_10225916
187 Ga0265320_10332835
188 Ga0265327_10005650
189 Ga0265327_10022763
190 Ga0265327_10171692
191 Ga0265316_10658829
192 Ga0265316_10723570
193 Ga0265316_10728792
194 Ga0307408_101620231
195 Ga0265314_10079130
196 Ga0307410_10358087
197 Ga0307416_100455591
198 Ga0307411_10733179
199 Ga0307415_100182846
200 Ga0373943_0050266
201 Ga0373931_0142200
202 Ga0373947_0084612
203 Ga0373925_1727220
204 Ga0395905_0450723
205 Ga0453684_0004390
206 Ga0451576_0123582
207 Ga0495630_0223794
208 Ga0495634_0730856
209 Ga0495658_0001303
210 Ga0495658_0681180
211 Ga0496115_0018729
212 Ga0501034_0066027
213 Ga0501036_0789191
214 Ga0501043_0204465
215 Ga0501233_164356
216 Ga0501257_021587
217 Ga0501083_0259815
218 nmdc:mga08y16_394360_c1
219 nmdc:mga0n895_331369_c1
220 Ga0590075_175163

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06155

GBBH-like_N

Gamma-butyrobetaine hydroxylase-like, N-terminal

18

111

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5n76-assembly2.cif.gz_C crystal structure of the apo-form of the co dehydrogenase accessory protein coot from rhodospirillum rubrum 0.9485 4 27
4bk1-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: h213s mutant in complex with 3-hydroxybenzoate 0.9434 3 26
4bjz-assembly1.cif.gz_A crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: native data 0.9277 3 28
4bjy-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: platinum derivative 0.926 3 28
4bk2-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: q301e mutant 0.9211 3 28
ID Description Score Start End Superfamily
af_Q54GQ0_68_145_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.9851 65 98 3.30.2020.30
af_Q9VP46_133_237_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.958 4 28 2.30.29.30
af_Q80U35_1727_1949_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9549 3 28 2.130.10.10
af_Q67XN8_89_261_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.9521 5 28 2.120.10.80
af_P27306_158_276_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9282 3 26 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2V5Z9A6-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9784 1 101 GO:0046872
AF-A0A838DCV9-F1-model_v4 DUF971 domain-containing protein 0.9747 1 101 GO:0046872
AF-A0A4Q3A5Z5-F1-model_v4 deleted 0.9733 1 98
AF-A0A2V5Z9A6-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.969 1 101 GO:0046872
AF-A0A838QDM3-F1-model_v4 DUF971 domain-containing protein 0.968 32 101 GO:0046872

Map