F057466

General Info

Members Datasets Scaffolds Average Seq Length
110 81 220 144

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100705254|Ga0070670_1007052541
Length 157
Sequence MHETINRLRNKKDDEGFTLIELLPVYLNYRKGAADKSAQSDVRGAVSAVEQFYTDNSNTYPIAANGGNNTGVSGQTSTTSLGLMLAANGTATQTITLSDKTQLSYVPVIPTGGTVATSYKLCGNNTGGSGKWYTYDSSVGGSVKAAAAAITNFASCT

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
44 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
45 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
46 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
49 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
54 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
55 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
56 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
57 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
58 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
59 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
60 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
61 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
62 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
63 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
68 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
69 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
70 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
71 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
72 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
73 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
74 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
75 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
76 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
77 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
78 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 3.64
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.36
Nodule 0
Rhizoplane 2.73
Rhizosphere 72.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100705254 3300005331 Bacteria 908
2 rootH2_10178935 3300003320 Bacteria 1005
3 rootL2_10055369 3300003322 Bacteria 4116
4 JGI25404J52841_10087112 3300003659 Bacteria 653
5 Ga0070668_100000450 3300005347 Bacteria 27207
6 Ga0070668_100372108 3300005347 Bacteria 1214
7 Ga0070668_100414954 3300005347 Bacteria 1152
8 Ga0070669_100700258 3300005353 Bacteria 855
9 Ga0070671_100395446 3300005355 Bacteria 1182
10 Ga0070667_100111224 3300005367 Bacteria 2376
11 Ga0070667_100182722 3300005367 Bacteria 1855
12 Ga0070679_100556105 3300005530 Bacteria 1091
13 Ga0068861_100898451 3300005719 Bacteria 839
14 Ga0068863_100148226 3300005841 Bacteria 2245
15 Ga0068858_100634176 3300005842 Bacteria 1038
16 Ga0068858_101011424 3300005842 Bacteria 815
17 Ga0068860_100138526 3300005843 Bacteria 2338
18 Ga0068862_100033679 3300005844 Bacteria 4333
19 Ga0068862_100117008 3300005844 Bacteria 2346
20 Ga0068862_100120588 3300005844 Bacteria 2311
21 Ga0081540_1009698 3300005983 Bacteria 6610
22 Ga0081539_10001812 3300005985 Bacteria 33770
23 Ga0081539_10017047 3300005985 Bacteria 5131
24 Ga0081539_10130202 3300005985 Bacteria 1237
25 Ga0081539_10285432 3300005985 Bacteria 716
26 Ga0075365_10317821 3300006038 Bacteria 1096
27 Ga0075428_100782975 3300006844 Bacteria 1014
28 Ga0075430_100037917 3300006846 Bacteria 4086
29 Ga0075429_100288686 3300006880 Bacteria 1436
30 Ga0105247_10085246 3300009101 Bacteria 1997
31 Ga0114129_11239369 3300009147 Bacteria 927
32 Ga0105248_10422024 3300009177 Bacteria 1502
33 Ga0105249_11328457 3300009553 Bacteria 791
34 Ga0157378_10263275 3300013297 Bacteria 1655
35 Ga0157378_10366230 3300013297 Bacteria 1412
36 Ga0163162_12210566 3300013306 Bacteria 632
37 Ga0157375_10913018 3300013308 Bacteria 1022
38 Ga0163163_10240760 3300014325 Bacteria 1859
39 Ga0157379_11161838 3300014968 Bacteria 741
40 Ga0207710_10230747 3300025900 Bacteria 921
41 Ga0207652_10398296 3300025921 Bacteria 1242
42 Ga0207681_10512689 3300025923 Bacteria 983
43 Ga0207650_10657579 3300025925 Bacteria 884
44 Ga0207687_10803855 3300025927 Bacteria 802
45 Ga0207644_10758428 3300025931 Bacteria 811
46 Ga0207689_10067341 3300025942 Bacteria 2943
47 Ga0207668_10003859 3300025972 Bacteria 8831
48 Ga0207668_10043950 3300025972 Bacteria 3036
49 Ga0207668_10157068 3300025972 Bacteria 1768
50 Ga0207658_10077044 3300025986 Bacteria 2543
51 Ga0207658_10220839 3300025986 Bacteria 1594
52 Ga0207703_10446317 3300026035 Bacteria 1207
53 Ga0207675_100110523 3300026118 Bacteria 2593
54 Ga0207675_100263642 3300026118 Bacteria 1670
55 Ga0207675_100805893 3300026118 Bacteria 953
56 Ga0268265_10013975 3300028380 Bacteria 5467
57 Ga0268265_10048959 3300028380 Bacteria 3176
58 Ga0268264_10421740 3300028381 Bacteria 1287
59 Ga0307517_10073915 3300028786 Bacteria 3014
60 Ga0307515_10000205 3300028794 Bacteria 144874
61 Ga0307515_10004232 3300028794 Bacteria 29810
62 Ga0307515_10028416 3300028794 Bacteria 9507
63 Ga0307515_10038625 3300028794 Bacteria 7628
64 Ga0307512_10021804 3300030522 Bacteria 5769
65 Ga0307513_10095087 3300031456 Bacteria 3022
66 Ga0307508_10001502 3300031616 Bacteria 26063
67 Ga0307508_10002861 3300031616 Bacteria 17906
68 Ga0307508_10206845 3300031616 Bacteria 1563
69 Ga0307508_10335786 3300031616 Bacteria 1103
70 Ga0307516_10000409 3300031730 Bacteria 56212
71 Ga0307516_10079654 3300031730 Bacteria 3120
72 Ga0307516_10472422 3300031730 Bacteria 909
73 Ga0307405_10577401 3300031731 Bacteria 914
74 Ga0307406_10437284 3300031901 Bacteria 1046
75 Ga0307406_10481039 3300031901 Bacteria 1003
76 Ga0307406_11662116 3300031901 Bacteria 565
77 Ga0307409_100059518 3300031995 Bacteria 2973
78 Ga0307409_100710438 3300031995 Bacteria 1005
79 Ga0307416_102941378 3300032002 Bacteria 570
80 Ga0307415_100168384 3300032126 Bacteria 1706
81 Ga0307415_100261319 3300032126 Bacteria 1413
82 Ga0307507_10086595 3300033179 Bacteria 2715
83 Ga0373938_0007676 3300034957 Bacteria 1905
84 Ga0373940_0129983 3300035088 Bacteria 788
85 Ga0373951_0000280 3300035091 Bacteria 16295
86 Ga0373942_0000069 3300035207 Bacteria 21776
87 Ga0373935_0001732 3300035692 Bacteria 12236
88 Ga0451791_0509375 3300041451 Bacteria 3361
89 Ga0451795_1619771 3300041456 Bacteria 609
90 Ga0451833_0991846 3300041491 Bacteria 1278
91 Ga0451841_1111492 3300041498 Bacteria 578
92 Ga0451853_0594015 3300041512 Bacteria 13506
93 Ga0439448_0083456 3300042005 Bacteria 1075
94 Ga0466957_0871109 3300044842 Bacteria 643
95 Ga0466960_0138511 3300044901 Bacteria 1291
96 Ga0495632_0019959 3300046519 Bacteria 3640
97 Ga0496108_0000117 3300048911 Bacteria 78204
98 nmdc:mga0yw44_311474_c1 3300050492 Bacteria 611
99 nmdc:mga0qj67_205689_c1 3300050509 Bacteria 1599
100 Ga0500644_0196005 3300053088 Bacteria 833
101 Ga0500646_0101940 3300053090 Bacteria 902
102 Ga0500641_0033054 3300053096 Bacteria 2050
103 Ga0500594_0126500 3300053118 Bacteria 806
104 Ga0500652_007919 3300053131 Bacteria 3510
105 Ga0501084_0946072 3300054114 Bacteria 724
106 Ga0587106_016322 3300059605 Bacteria 1049
107 Ga0587068_032237 3300059641 Bacteria 914
108 Ga0587111_0078643 3300060346 Bacteria 784
109 Ga0587111_0099564 3300060346 Bacteria 722
110 2753263447 2751185782 Bacteria 11227053
111 Ga0070670_100705254
112 rootH2_10178935
113 rootL2_10055369
114 JGI25404J52841_10087112
115 Ga0070668_100000450
116 Ga0070668_100372108
117 Ga0070668_100414954
118 Ga0070669_100700258
119 Ga0070671_100395446
120 Ga0070667_100111224
121 Ga0070667_100182722
122 Ga0070679_100556105
123 Ga0068861_100898451
124 Ga0068863_100148226
125 Ga0068858_100634176
126 Ga0068858_101011424
127 Ga0068860_100138526
128 Ga0068862_100033679
129 Ga0068862_100117008
130 Ga0068862_100120588
131 Ga0081540_1009698
132 Ga0081539_10001812
133 Ga0081539_10017047
134 Ga0081539_10130202
135 Ga0081539_10285432
136 Ga0075365_10317821
137 Ga0075428_100782975
138 Ga0075430_100037917
139 Ga0075429_100288686
140 Ga0105247_10085246
141 Ga0114129_11239369
142 Ga0105248_10422024
143 Ga0105249_11328457
144 Ga0157378_10263275
145 Ga0157378_10366230
146 Ga0163162_12210566
147 Ga0157375_10913018
148 Ga0163163_10240760
149 Ga0157379_11161838
150 Ga0207710_10230747
151 Ga0207652_10398296
152 Ga0207681_10512689
153 Ga0207650_10657579
154 Ga0207687_10803855
155 Ga0207644_10758428
156 Ga0207689_10067341
157 Ga0207668_10003859
158 Ga0207668_10043950
159 Ga0207668_10157068
160 Ga0207658_10077044
161 Ga0207658_10220839
162 Ga0207703_10446317
163 Ga0207675_100110523
164 Ga0207675_100263642
165 Ga0207675_100805893
166 Ga0268265_10013975
167 Ga0268265_10048959
168 Ga0268264_10421740
169 Ga0307517_10073915
170 Ga0307515_10000205
171 Ga0307515_10004232
172 Ga0307515_10028416
173 Ga0307515_10038625
174 Ga0307512_10021804
175 Ga0307513_10095087
176 Ga0307508_10001502
177 Ga0307508_10002861
178 Ga0307508_10206845
179 Ga0307508_10335786
180 Ga0307516_10000409
181 Ga0307516_10079654
182 Ga0307516_10472422
183 Ga0307405_10577401
184 Ga0307406_10437284
185 Ga0307406_10481039
186 Ga0307406_11662116
187 Ga0307409_100059518
188 Ga0307409_100710438
189 Ga0307416_102941378
190 Ga0307415_100168384
191 Ga0307415_100261319
192 Ga0307507_10086595
193 Ga0373938_0007676
194 Ga0373940_0129983
195 Ga0373951_0000280
196 Ga0373942_0000069
197 Ga0373935_0001732
198 Ga0451791_0509375
199 Ga0451795_1619771
200 Ga0451833_0991846
201 Ga0451841_1111492
202 Ga0451853_0594015
203 Ga0439448_0083456
204 Ga0466957_0871109
205 Ga0466960_0138511
206 Ga0495632_0019959
207 Ga0496108_0000117
208 nmdc:mga0yw44_311474_c1
209 nmdc:mga0qj67_205689_c1
210 Ga0500644_0196005
211 Ga0500646_0101940
212 Ga0500641_0033054
213 Ga0500594_0126500
214 Ga0500652_007919
215 Ga0501084_0946072
216 Ga0587106_016322
217 Ga0587068_032237
218 Ga0587111_0078643
219 Ga0587111_0099564
220 2753263447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g2f-assembly1.cif.gz_B type iv-like competence pilin ttha1222 from thermus thermophilus 0.7117 36 143
6htn-assembly1.cif.gz_D structure of a fucose lectin from kordia zhangzhouensis in complex with methyl-fucoside 0.6837 102 148
3mx7-assembly1.cif.gz_A crystal structure analysis of human faim-ntd 0.6699 105 134
5g2f-assembly1.cif.gz_B type iv-like competence pilin ttha1222 from thermus thermophilus 0.6677 36 143
6iy0-assembly1.cif.gz_A crystal structure of conserved hypothetical protein sav0927 from staphylococcus aureus subsp. aureus mu50 0.6578 102 144
ID Description Score Start End Superfamily
af_Q4W5R0_1_262_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.752 102 149 3.80.10.10
af_P34402_579_790_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7149 98 144 2.40.50.100
5g2fB00 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2; 0.7117 36 143 3.30.1300.70
af_Q6DR20_47_300_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6729 106 151 2.130.10.10
5g2fB00 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2; 0.6677 36 143 3.30.1300.70
ID Description Score Start End GO Terms
AF-A0A542IC52-F1-model_v4 deleted 0.8745 99 144
AF-G8RZQ1-F1-model_v4 DUF2510 domain-containing protein 0.8169 27 153 GO:0016020
AF-A0A124G8U0-F1-model_v4 Uncharacterized protein 0.7837 26 153
AF-A0A534V775-F1-model_v4 Type II secretion system protein 0.766 1 142 GO:0005886
GO:0015627
GO:0015628
AF-A0A3M0ZPR1-F1-model_v4 Uncharacterized protein 0.7592 4 142

Map