F056627

General Info

Members Datasets Scaffolds Average Seq Length
109 104 218 247

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2912757875|2912764494
Length 263
Sequence EVPLASPTFRLAYVPGVIPGKWVRIWNERLPDIPLTLTTVSAAEAADTLRADGADAGFVRLPVDRTDLSAIPLYTETTVVLVPKDHLVAAVDEVSVADLADDILLHPLDDTLDWAGPLPGRPANERPATTADAVELVAAGIGLLVVPQSLARLHHRKDLTYRPVSDAPESRVALSWPQERTTDLVEEFIGIVRGRTVNSSRGRRPAPAQQQASKTKPKPKHGRSDAGGARRKPAAGGSTGKNPRGGGSGGAKSGRRGKPGRRS

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
3 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
4 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
6 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
7 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
8 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
9 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
10 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
11 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
12 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
13 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
14 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
15 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
16 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
17 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
18 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
19 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
20 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
21 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
22 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
23 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
24 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
25 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
26 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
27 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
28 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
29 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
30 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
31 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
32 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
33 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
34 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
35 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
36 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
37 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
38 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
39 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
40 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
41 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
42 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
43 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
44 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
45 2643221647 Streptomyces sp. Root369 Isolate Unclassified
46 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
47 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
48 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
49 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
50 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
51 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
52 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
53 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
54 2808606448 Streptomyces sp. 193411 Isolate Unclassified
55 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
56 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
57 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
58 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
59 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
60 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
61 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
62 2862574272 Streptomyces sp. AcE210 Isolate Nodule
63 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
64 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
65 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
66 2867428634 Streptomyces sp. RP5T Isolate Unclassified
67 2867475112 Streptomyces sp. TM32 Isolate Unclassified
68 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
69 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
70 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
71 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
72 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
73 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
74 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
75 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
76 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
77 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
78 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
79 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
80 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
81 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
82 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
83 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
84 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
85 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
86 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
87 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
88 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
89 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
90 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
91 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
92 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
93 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
94 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
95 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
96 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
97 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
98 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
99 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
100 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
101 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
102 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
103 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
104 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 41.28
Metatranscriptomes 0
Isolates 58.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.75
Nodule 1.83
Rhizoplane 0.92
Rhizosphere 64.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100175416 3300005435 Bacteria 1948
2 Ga0070713_100219326 3300005436 Bacteria 1725
3 Ga0070684_100373632 3300005535 Bacteria 1313
4 Ga0081539_10000214 3300005985 Bacteria 135110
5 Ga0183367_1003 3300015688 Bacteria 814276
6 Ga0207426_1016393 3300025302 Bacteria 2661
7 Ga0207426_1019988 3300025302 Bacteria 2334
8 Ga0207687_10573748 3300025927 Bacteria 948
9 Ga0207700_10135059 3300025928 Bacteria 2019
10 Ga0207700_10278386 3300025928 Bacteria 1438
11 Ga0207664_10150021 3300025929 Bacteria 1980
12 Ga0207679_10106959 3300025945 Bacteria 2200
13 Ga0307515_10057057 3300028794 Bacteria 5659
14 Ga0307511_10060021 3300030521 Bacteria 2916
15 Ga0307513_10064511 3300031456 Bacteria 3859
16 Ga0307508_10007544 3300031616 Bacteria 10101
17 Ga0307514_10049109 3300031649 Bacteria 3283
18 Ga0307416_100313161 3300032002 Bacteria 1567
19 Ga0307507_10073354 3300033179 Bacteria 3077
20 Ga0307507_10121444 3300033179 Bacteria 2088
21 Ga0466969_0072369 3300044656 Bacteria 1656
22 Ga0466966_0006971 3300044684 Bacteria 7480
23 Ga0466971_0174637 3300044719 Bacteria 1009
24 Ga0466968_0135410 3300044735 Bacteria 1123
25 Ga0466957_0157595 3300044842 Bacteria 1473
26 Ga0466960_0032038 3300044901 Bacteria 2430
27 Ga0466959_0101074 3300045049 Bacteria 2064
28 Ga0466967_0015197 3300045976 Bacteria 6028
29 Ga0495629_0019815 3300046459 Bacteria 4801
30 Ga0495629_0183373 3300046459 Bacteria 1450
31 Ga0495582_0120191 3300046473 Bacteria 1480
32 Ga0495639_0218028 3300046475 Bacteria 937
33 Ga0495662_0009351 3300046476 Bacteria 4808
34 Ga0495635_0111737 3300046663 Bacteria 1866
35 Ga0495588_0195857 3300046674 Bacteria 1067
36 Ga0495657_0001424 3300046675 Bacteria 20694
37 Ga0495613_0035836 3300046689 Bacteria 3680
38 Ga0495600_0263032 3300046809 Bacteria 1095
39 Ga0496106_0045881 3300048909 Bacteria 3284
40 Ga0501047_0064367 3300049581 Bacteria 3536
41 Ga0501070_0548821 3300049586 Bacteria 925
42 Ga0501035_0279229 3300049822 Bacteria 1412
43 Ga0501035_0529595 3300049822 Bacteria 967
44 Ga0501044_0095498 3300049823 Bacteria 2995
45 Ga0500573_0131347 3300053140 Bacteria 1387
46 2912764494 2912757875 Bacteria 7940295
47 2585306549 2582581313 Bacteria 10042643
48 2616902980 2616644941 Bacteria 8510691
49 2643944299 2643221587 Bacteria 7586415
50 2644263401 2643221647 Bacteria 10741251
51 2644406163 2643221673 Bacteria 9196637
52 2644431144 2643221677 Bacteria 7584031
53 2644460177 2643221682 Bacteria 6743283
54 2768646581 2767802112 Bacteria 6465194
55 2776372857 2775506925 Bacteria 7237746
56 2784586372 2784132148 Bacteria 8627943
57 2785366644 2784746768 Bacteria 10036182
58 2808847169 2808606359 Bacteria 9866990
59 2809229872 2808606448 Bacteria 8656184
60 2811842750 2808606982 Bacteria 7791042
61 2812360788 2811994879 Bacteria 9313447
62 2812482719 2811994917 Bacteria 7761064
63 2816426536 2816332119 Bacteria 8120218
64 2852639476 2852635781 Bacteria 8251373
65 2862293026 2862290372 Bacteria 7471434
66 2862516106 2862507626 Bacteria 9425308
67 2862580790 2862574272 Bacteria 10567477
68 2863075574 2863067949 Bacteria 8541735
69 2866553532 2866552031 Bacteria 5824618
70 2866617777 2866612099 Bacteria 7543886
71 2867428759 2867428634 Bacteria 9590268
72 2867480843 2867475112 Bacteria 6909112
73 2875392773 2875391855 Bacteria 7600475
74 2877683907 2877676314 Bacteria 9512378
75 2915770442 2915768154 Bacteria 8424322
76 2917743750 2917736166 Bacteria 9690793
77 2918508143 2918501144 Bacteria 8668083
78 2919469967 2919468124 Bacteria 9133025
79 2935394804 2935390628 Bacteria 7043367
80 2946051938 2946045630 Bacteria 8527308
81 2946065083 2946064051 Bacteria 8957905
82 2946073513 2946072368 Bacteria 8999607
83 2947232342 2947224130 Bacteria 9938529
84 2954008419 2954002825 Bacteria 9173742
85 2954389188 2954380949 Bacteria 10050426
86 2954673856 2954673503 Bacteria 9685905
87 2954690136 2954682443 Bacteria 9862841
88 2954699966 2954691527 Bacteria 10720516
89 2954702252 2954701450 Bacteria 10834262
90 2954718808 2954711539 Bacteria 10867210
91 2954728777 2954721474 Bacteria 10456478
92 2954733033 2954731030 Bacteria 10243860
93 2954747677 2954740390 Bacteria 10229294
94 2954751913 2954749733 Bacteria 10366972
95 2954766799 2954759201 Bacteria 9358192
96 2966604306 2966598605 Bacteria 7676064
97 2990061416 2990059506 Bacteria 9321252
98 2990091586 2990088156 Bacteria 6657676
99 2997452085 2997451912 Bacteria 8492419
100 3006325437 3006321560 Bacteria 8247479
101 3006395703 3006393351 Bacteria 6615579
102 3006488837 3006486233 Bacteria 8157040
103 8008561402 8008558824 Bacteria 10610750
104 8025418802 8025413630 Bacteria 7014048
105 8025534993 8025530807 Bacteria 8495698
106 8047710519 8047710418 Bacteria 11023148
107 8056211666 8056207758 Bacteria 8639239
108 8056451078 8056447290 Bacteria 7680491
109 8056670185 8056667051 Bacteria 6953971
110 Ga0070714_100175416
111 Ga0070713_100219326
112 Ga0070684_100373632
113 Ga0081539_10000214
114 Ga0183367_1003
115 Ga0207426_1016393
116 Ga0207426_1019988
117 Ga0207687_10573748
118 Ga0207700_10135059
119 Ga0207700_10278386
120 Ga0207664_10150021
121 Ga0207679_10106959
122 Ga0307515_10057057
123 Ga0307511_10060021
124 Ga0307513_10064511
125 Ga0307508_10007544
126 Ga0307514_10049109
127 Ga0307416_100313161
128 Ga0307507_10073354
129 Ga0307507_10121444
130 Ga0466969_0072369
131 Ga0466966_0006971
132 Ga0466971_0174637
133 Ga0466968_0135410
134 Ga0466957_0157595
135 Ga0466960_0032038
136 Ga0466959_0101074
137 Ga0466967_0015197
138 Ga0495629_0019815
139 Ga0495629_0183373
140 Ga0495582_0120191
141 Ga0495639_0218028
142 Ga0495662_0009351
143 Ga0495635_0111737
144 Ga0495588_0195857
145 Ga0495657_0001424
146 Ga0495613_0035836
147 Ga0495600_0263032
148 Ga0496106_0045881
149 Ga0501047_0064367
150 Ga0501070_0548821
151 Ga0501035_0279229
152 Ga0501035_0529595
153 Ga0501044_0095498
154 Ga0500573_0131347
155 2912764494
156 2585306549
157 2616902980
158 2643944299
159 2644263401
160 2644406163
161 2644431144
162 2644460177
163 2768646581
164 2776372857
165 2784586372
166 2785366644
167 2808847169
168 2809229872
169 2811842750
170 2812360788
171 2812482719
172 2816426536
173 2852639476
174 2862293026
175 2862516106
176 2862580790
177 2863075574
178 2866553532
179 2866617777
180 2867428759
181 2867480843
182 2875392773
183 2877683907
184 2915770442
185 2917743750
186 2918508143
187 2919469967
188 2935394804
189 2946051938
190 2946065083
191 2946073513
192 2947232342
193 2954008419
194 2954389188
195 2954673856
196 2954690136
197 2954699966
198 2954702252
199 2954718808
200 2954728777
201 2954733033
202 2954747677
203 2954751913
204 2954766799
205 2966604306
206 2990061416
207 2990091586
208 2997452085
209 3006325437
210 3006395703
211 3006488837
212 8008561402
213 8025418802
214 8025534993
215 8047710519
216 8056211666
217 8056451078
218 8056670185

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03466

LysR_substrate

LysR substrate binding domain

4

196

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xro-assembly1.cif.gz_C lysr-family transcriptional regulator ripr effector binding domain with its effector, 3-phenylpropionic acid 0.8081 8 192
7w08-assembly2.cif.gz_B itaconate inducible lysr-type transcriptional regulator (itcr) in apo form, space group p1. 0.797 9 192
2h9b-assembly1.cif.gz_A crystal structure of the effector binding domain of a benm variant (benm r156h/t157s) 0.7913 9 193
3glb-assembly2.cif.gz_C crystal structure of the effector binding domain of a catm variant (r156h) 0.7768 7 193
1i69-assembly1.cif.gz_B crystal structure of the reduced form of oxyr 0.7628 6 195
ID Description Score Start End Superfamily
2f7cA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8913 7 75 3.40.190.10
5b7dB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8392 9 75 3.40.190.10
1iz1B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8368 8 74 3.40.190.10
2ql3D01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8303 9 74 3.40.190.10
1i69B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8246 6 75 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7Y9MJ24-F1-model_v4 DNA-binding transcriptional LysR family regulator 0.9225 6 199 GO:0003677
GO:0003700
GO:0032993
AF-A0A4V2JS67-F1-model_v4 LysR family transcriptional regulator 0.9089 10 204 GO:0003677
GO:0003700
GO:0032993
AF-A0A7K2A2H1-F1-model_v4 LysR family transcriptional regulator 0.8979 9 192 GO:0003677
GO:0003700
GO:0032993
AF-A0A4V2JS67-F1-model_v4 LysR family transcriptional regulator 0.8945 10 204 GO:0003677
GO:0003700
GO:0032993
AF-A0A1P8YF92-F1-model_v4 LysR substrate binding domain protein 0.8888 1 218 GO:0003677
GO:0003700
GO:0032993

Map