F052738

General Info

Members Datasets Scaffolds Average Seq Length
109 95 109 188

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100516384|Ga0070714_1005163843
Length 194
Sequence VRPTVAEPALPDKVVAVHQALDGAGVPHAFGGALALAYYAEPRATVDIDVNVFVAPPKLPQVAGALAPLGVETAAADVVADVHREGQTRVWWGRTPLDLFFSYHPLHRAMARDARLVPFGAESIPILSPEHLVTCKAVFDRRKDWLDIEQVLLAVPELHPAEALAWVADLVGREDPRRRRLGAVVEELLGAGEG

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
4 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
5 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
6 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
7 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
8 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
12 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
13 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
21 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
31 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
32 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
33 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
34 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
35 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
36 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
37 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
38 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
42 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
43 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
44 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
45 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
46 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
47 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
48 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
49 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
50 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
51 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
52 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
53 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
54 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
55 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
56 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
57 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
58 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
59 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
60 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
61 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
62 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
63 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
64 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
65 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
66 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
67 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
68 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
69 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
70 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
71 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
72 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
73 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
74 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
75 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
76 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
77 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
78 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
85 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
86 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
87 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
88 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
89 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
90 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
91 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
92 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
93 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
94 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
95 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.75
Nodule 0
Rhizoplane 13.76
Rhizosphere 81.65
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100078422 3300005366 Bacteria 2635
2 Ga0070714_100516384 3300005435 Bacteria 1141
3 Ga0070711_100001471 3300005439 Bacteria 12945
4 Ga0070711_100176649 3300005439 Bacteria 1632
5 Ga0070694_100299187 3300005444 Bacteria 1232
6 Ga0070665_100452155 3300005548 Bacteria 1294
7 Ga0068852_100507827 3300005616 Bacteria 1201
8 Ga0068861_100713321 3300005719 Bacteria 933
9 Ga0081539_10003996 3300005985 Bacteria 17009
10 Ga0070717_10892267 3300006028 Bacteria 809
11 Ga0075363_100060860 3300006048 Bacteria 2034
12 Ga0070716_100139608 3300006173 Bacteria 1543
13 Ga0070712_100000186 3300006175 Bacteria 34602
14 Ga0075433_10002113 3300006852 Bacteria 15055
15 Ga0105240_10009093 3300009093 Bacteria 14105
16 Ga0111539_10597227 3300009094 Unclassified 1285
17 Ga0114129_10229696 3300009147 Bacteria 2499
18 Ga0105242_10058847 3300009176 Bacteria 3152
19 Ga0157370_10017447 3300013104 Bacteria 7242
20 Ga0157375_10089009 3300013308 Bacteria 3143
21 Ga0163163_10270426 3300014325 Bacteria 1751
22 Ga0157380_10003168 3300014326 Bacteria 11228
23 Ga0213876_10052183 3300021384 Bacteria 2161
24 Ga0207695_10007814 3300025913 Bacteria 13535
25 Ga0207693_10468213 3300025915 Bacteria 984
26 Ga0207693_10728099 3300025915 Bacteria 767
27 Ga0207663_10001276 3300025916 Bacteria 11682
28 Ga0207663_10252284 3300025916 Bacteria 1299
29 Ga0207664_10429636 3300025929 Bacteria 1177
30 Ga0207690_10048398 3300025932 Bacteria 2827
31 Ga0207675_100680069 3300026118 Bacteria 1037
32 Ga0268264_11572953 3300028381 Bacteria 668
33 Ga0265337_1000580 3300028556 Bacteria 19200
34 Ga0265326_10001854 3300028558 Bacteria 7252
35 Ga0265319_1000933 3300028563 Bacteria 18289
36 Ga0265318_10000815 3300028577 Bacteria 20578
37 Ga0265336_10000002 3300028666 Bacteria 830172
38 Ga0265338_10000001 3300028800 Bacteria 1177449
39 Ga0265338_10072068 3300028800 Bacteria 2951
40 Ga0265324_10000705 3300029957 Bacteria 22233
41 Ga0265340_10000001 3300031247 Bacteria 1647668
42 Ga0265339_10016169 3300031249 Bacteria 4455
43 Ga0265327_10001291 3300031251 Bacteria 32872
44 Ga0265327_10018984 3300031251 Bacteria 4243
45 Ga0265316_10045952 3300031344 Bacteria 3463
46 Ga0265342_10053188 3300031712 Bacteria 2411
47 Ga0316576_10123889 3300031727 Bacteria 1942
48 Ga0316574_0079493 3300035398 Bacteria 2080
49 Ga0373947_0514065 3300035725 Bacteria 814
50 Ga0395905_0201227 3300037471 Bacteria 1867
51 Ga0436365_1496962 3300039437 Bacteria 5157
52 Ga0495603_0007298 3300046455 Bacteria 6644
53 Ga0495641_0034889 3300046461 Bacteria 2375
54 Ga0495651_0067764 3300046462 Bacteria 2722
55 Ga0495582_0000082 3300046473 Bacteria 48118
56 Ga0495664_0240629 3300046477 Archaea 1095
57 Ga0495608_0013561 3300046511 Bacteria 5653
58 Ga0495618_0000097 3300046514 Bacteria 63474
59 Ga0495628_0003972 3300046516 Bacteria 13174
60 Ga0495630_0001301 3300046517 Bacteria 17211
61 Ga0495644_0001570 3300046523 Bacteria 9309
62 Ga0495587_0019204 3300046536 Bacteria 4234
63 Ga0495634_0000092 3300046642 Bacteria 72088
64 Ga0495625_0000095 3300046660 Bacteria 143468
65 Ga0495599_0309647 3300046678 Bacteria 952
66 Ga0495647_0000938 3300046681 Bacteria 8769
67 Ga0495658_0000070 3300046683 Bacteria 52450
68 Ga0495670_0006883 3300046691 Bacteria 5594
69 Ga0495600_0012890 3300046809 Bacteria 5238
70 Ga0495604_0000038 3300047317 Bacteria 123703
71 Ga0495676_0091982 3300047321 Bacteria 2265
72 Ga0495680_0000050 3300047322 Bacteria 95945
73 Ga0495680_0066321 3300047322 Bacteria 2763
74 Ga0495685_048871 3300047447 Unclassified 1438
75 Ga0495684_0486341 3300047471 Unclassified 851
76 Ga0496101_0106407 3300048904 Bacteria 2106
77 Ga0496104_0001440 3300048907 Bacteria 20567
78 Ga0496104_0019392 3300048907 Bacteria 6222
79 Ga0496104_0425459 3300048907 Bacteria 1240
80 Ga0496104_0556988 3300048907 Bacteria 1057
81 Ga0496105_0000095 3300048908 Bacteria 60866
82 Ga0496105_0358680 3300048908 Unclassified 1163
83 Ga0496105_0425336 3300048908 Bacteria 1051
84 Ga0496106_0223164 3300048909 Bacteria 1503
85 Ga0496108_0093233 3300048911 Bacteria 2561
86 Ga0496109_0251330 3300048912 Bacteria 1665
87 Ga0496109_0398392 3300048912 Bacteria 1300
88 Ga0496112_0002277 3300048915 Bacteria 15347
89 Ga0496114_0127726 3300048917 Bacteria 2193
90 Ga0496115_0037819 3300048918 Bacteria 3826
91 Ga0501034_0001520 3300049571 Bacteria 30470
92 Ga0501037_0110068 3300049573 Bacteria 1985
93 Ga0501042_0021689 3300049578 Bacteria 4479
94 Ga0501067_0176121 3300049583 Bacteria 1191
95 Ga0501070_0005221 3300049586 Bacteria 11071
96 Ga0501072_0002277 3300049588 Bacteria 14350
97 Ga0501073_0000347 3300049589 Bacteria 31151
98 Ga0501076_0320962 3300049592 Bacteria 1270
99 nmdc:mga00v17_340805_c1 3300050491 Bacteria 974
100 nmdc:mga0n895_394777_c1 3300050512 Unclassified 1399
101 nmdc:mga0rr50_904492_c1 3300050513 Unclassified 752
102 nmdc:mga0a205_1629_c2 3300050515 Bacteria 15476
103 Ga0495601_0040191 3300053077 Bacteria 2929
104 Ga0495595_0000362 3300053084 Bacteria 17220
105 Ga0495595_0144398 3300053084 Bacteria 1169
106 Ga0495619_0000060 3300053085 Bacteria 89377
107 Ga0495619_0000896 3300053085 Bacteria 19523
108 Ga0500604_0012144 3300053151 Bacteria 2322
109 Ga0501084_0000548 3300054114 Bacteria 28624

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0000095 Ga0495625_0000095_130958_131473 171
2 3300028381 Ga0268264_11572953 Ga0268264_115729531 173
3 3300049578 Ga0501042_0021689 Ga0501042_0021689_512_1033 173
4 3300005985 Ga0081539_10003996 Ga0081539_1000399614 175
5 3300048917 Ga0496114_0127726 Ga0496114_0127726_1147_1680 176
6 3300005616 Ga0068852_100507827 Ga0068852_1005078272 177
7 3300048907 Ga0496104_0425459 Ga0496104_0425459_686_1219 177
8 3300048911 Ga0496108_0093233 Ga0496108_0093233_1279_1812 177
9 3300048912 Ga0496109_0398392 Ga0496109_0398392_469_1002 177
10 3300053151 Ga0500604_0012144 Ga0500604_0012144_1169_1702 177
11 3300039437 Ga0436365_1496962 Ga0436365_1496962_2325_2864 179
12 3300031727 Ga0316576_10123889 Ga0316576_101238893 180
13 3300035398 Ga0316574_0079493 Ga0316574_0079493_618_1160 180
14 3300049571 Ga0501034_0001520 Ga0501034_0001520_16258_16803 180
15 3300049573 Ga0501037_0110068 Ga0501037_0110068_359_904 180
16 3300049583 Ga0501067_0176121 Ga0501067_0176121_566_1111 180
17 3300049586 Ga0501070_0005221 Ga0501070_0005221_7076_7621 180
18 3300049588 Ga0501072_0002277 Ga0501072_0002277_508_1053 180
19 3300049589 Ga0501073_0000347 Ga0501073_0000347_2378_2923 180
20 3300049592 Ga0501076_0320962 Ga0501076_0320962_406_951 180
21 3300048908 Ga0496105_0358680 Ga0496105_0358680_433_981 181
22 3300054114 Ga0501084_0000548 Ga0501084_0000548_17732_18280 181
23 3300005439 Ga0070711_100176649 Ga0070711_1001766492 182
24 3300006028 Ga0070717_10892267 Ga0070717_108922672 182
25 3300006175 Ga0070712_100000186 Ga0070712_1000001869 182
26 3300021384 Ga0213876_10052183 Ga0213876_100521833 182
27 3300025915 Ga0207693_10728099 Ga0207693_107280991 182
28 3300025916 Ga0207663_10252284 Ga0207663_102522842 182
29 3300048904 Ga0496101_0106407 Ga0496101_0106407_460_1011 182
30 3300048907 Ga0496104_0019392 Ga0496104_0019392_5091_5642 182
31 3300048908 Ga0496105_0425336 Ga0496105_0425336_309_860 182
32 3300048909 Ga0496106_0223164 Ga0496106_0223164_586_1137 182
33 3300048915 Ga0496112_0002277 Ga0496112_0002277_406_954 182
34 3300048918 Ga0496115_0037819 Ga0496115_0037819_1485_2036 182
35 3300050512 nmdc:mga0n895_394777_c1 nmdc:mga0n895_394777_c1_123_674 182
36 3300009093 Ga0105240_10009093 Ga0105240_100090933 184
37 3300025913 Ga0207695_10007814 Ga0207695_100078143 184
38 3300028800 Ga0265338_10072068 Ga0265338_100720683 184
39 3300050513 nmdc:mga0rr50_904492_c1 nmdc:mga0rr50_904492_c1_150_704 184
40 3300006048 Ga0075363_100060860 Ga0075363_1000608602 185
41 3300009094 Ga0111539_10597227 Ga0111539_105972272 185
42 3300009147 Ga0114129_10229696 Ga0114129_102296963 185
43 3300037471 Ga0395905_0201227 Ga0395905_0201227_21_584 185
44 3300050491 nmdc:mga00v17_340805_c1 nmdc:mga00v17_340805_c1_241_798 185
45 3300028556 Ga0265337_1000580 Ga0265337_100058010 186
46 3300028558 Ga0265326_10001854 Ga0265326_100018544 186
47 3300028563 Ga0265319_1000933 Ga0265319_100093310 186
48 3300028577 Ga0265318_10000815 Ga0265318_1000081519 186
49 3300028666 Ga0265336_10000002 Ga0265336_10000002718 186
50 3300028800 Ga0265338_10000001 Ga0265338_1000000194 186
51 3300029957 Ga0265324_10000705 Ga0265324_100007059 186
52 3300031247 Ga0265340_10000001 Ga0265340_1000000194 186
53 3300031249 Ga0265339_10016169 Ga0265339_100161696 186
54 3300031344 Ga0265316_10045952 Ga0265316_100459523 186
55 3300031712 Ga0265342_10053188 Ga0265342_100531883 186
56 3300031251 Ga0265327_10001291 Ga0265327_1000129128 188
57 3300005439 Ga0070711_100001471 Ga0070711_1000014715 189
58 3300005548 Ga0070665_100452155 Ga0070665_1004521551 189
59 3300005719 Ga0068861_100713321 Ga0068861_1007133212 189
60 3300025916 Ga0207663_10001276 Ga0207663_100012769 189
61 3300026118 Ga0207675_100680069 Ga0207675_1006800692 189
62 3300031251 Ga0265327_10018984 Ga0265327_100189843 189
63 3300046477 Ga0495664_0240629 Ga0495664_0240629_233_802 189
64 3300048907 Ga0496104_0556988 Ga0496104_0556988_233_805 189
65 3300053084 Ga0495595_0144398 Ga0495595_0144398_213_788 189
66 3300005444 Ga0070694_100299187 Ga0070694_1002991872 190
67 3300047322 Ga0495680_0066321 Ga0495680_0066321_449_1024 191
68 3300053085 Ga0495619_0000896 Ga0495619_0000896_13515_14090 191
69 3300005435 Ga0070714_100516384 Ga0070714_1005163843 192
70 3300025929 Ga0207664_10429636 Ga0207664_104296361 192
71 3300009176 Ga0105242_10058847 Ga0105242_100588474 193
72 3300013104 Ga0157370_10017447 Ga0157370_1001744711 193
73 3300053085 Ga0495619_0000060 Ga0495619_0000060_37588_38169 193
74 3300014325 Ga0163163_10270426 Ga0163163_102704262 194
75 3300025915 Ga0207693_10468213 Ga0207693_104682132 194
76 3300046462 Ga0495651_0067764 Ga0495651_0067764_514_1098 194
77 3300046514 Ga0495618_0000097 Ga0495618_0000097_26252_26836 194
78 3300046809 Ga0495600_0012890 Ga0495600_0012890_2887_3471 194
79 3300047322 Ga0495680_0000050 Ga0495680_0000050_12881_13465 194
80 3300014326 Ga0157380_10003168 Ga0157380_1000316810 195
81 3300047317 Ga0495604_0000038 Ga0495604_0000038_23363_23950 195
82 3300013308 Ga0157375_10089009 Ga0157375_100890093 196
83 3300035725 Ga0373947_0514065 Ga0373947_0514065_51_641 196
84 3300046523 Ga0495644_0001570 Ga0495644_0001570_8657_9247 196
85 3300047447 Ga0495685_048871 Ga0495685_048871_151_741 196
86 3300047471 Ga0495684_0486341 Ga0495684_0486341_115_705 196
87 3300006852 Ga0075433_10002113 Ga0075433_1000211316 197
88 3300046455 Ga0495603_0007298 Ga0495603_0007298_2764_3357 197
89 3300046473 Ga0495582_0000082 Ga0495582_0000082_27105_27698 197
90 3300046536 Ga0495587_0019204 Ga0495587_0019204_3431_4024 197
91 3300046642 Ga0495634_0000092 Ga0495634_0000092_4184_4777 197
92 3300046683 Ga0495658_0000070 Ga0495658_0000070_27127_27720 197
93 3300046691 Ga0495670_0006883 Ga0495670_0006883_1901_2494 197
94 3300048907 Ga0496104_0001440 Ga0496104_0001440_6811_7404 197
95 3300048908 Ga0496105_0000095 Ga0496105_0000095_57311_57904 197
96 3300048912 Ga0496109_0251330 Ga0496109_0251330_437_1030 197
97 3300050515 nmdc:mga0a205_1629_c2 nmdc:mga0a205_1629_c2_13370_13963 197
98 3300053077 Ga0495601_0040191 Ga0495601_0040191_1078_1671 197
99 3300005366 Ga0070659_100078422 Ga0070659_1000784222 198
100 3300006173 Ga0070716_100139608 Ga0070716_1001396082 198
101 3300025932 Ga0207690_10048398 Ga0207690_100483982 198
102 3300046461 Ga0495641_0034889 Ga0495641_0034889_119_715 198
103 3300046511 Ga0495608_0013561 Ga0495608_0013561_3272_3868 198
104 3300046516 Ga0495628_0003972 Ga0495628_0003972_11438_12034 198
105 3300046517 Ga0495630_0001301 Ga0495630_0001301_10116_10712 198
106 3300046678 Ga0495599_0309647 Ga0495599_0309647_149_745 198
107 3300046681 Ga0495647_0000938 Ga0495647_0000938_2980_3576 198
108 3300047321 Ga0495676_0091982 Ga0495676_0091982_1377_1973 198
109 3300053084 Ga0495595_0000362 Ga0495595_0000362_12858_13454 198

Structural Annotation

Top 5 Hits

ID Description Score Start End
8an5-assembly1.cif.gz_A menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.8236 19 192
8an5-assembly1.cif.gz_B menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.8103 17 188
8an4-assembly1.cif.gz_A ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv 0.8083 14 191
8an4-assembly2.cif.gz_B ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv 0.8061 19 189
8an5-assembly1.cif.gz_B menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.76 17 188
ID Description Score Start End Superfamily
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.8395 13 157 3.30.460.40
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.7709 13 157 3.30.460.40
4wbzB01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7102 23 108 3.30.460.10
4e8iA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.6839 19 160 3.30.460.40
4wbyA01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6809 14 107 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A535CX23-F1-model_v4 Nucleotidyltransferase family protein 0.9762 12 193 GO:0016740
AF-A0A3A0FQZ3-F1-model_v4 Nucleotidyltransferase family protein 0.9745 14 191
AF-A0A7V8ZL64-F1-model_v4 Nucleotidyl transferase AbiEii/AbiGii toxin family protein 0.9671 17 191 GO:0016740
AF-A0A7W1S2D8-F1-model_v4 deleted 0.9632 14 194
AF-A0A538CS74-F1-model_v4 Nucleotidyltransferase family protein 0.963 15 192

Feature Viewer

pLDDT pTM Quality
92.88 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map