F051514

General Info

Members Datasets Scaffolds Average Seq Length
108 94 216 247

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8057345674|8057349370
Length 277
Sequence VRRNPRAHFAIGLLAASVIALLAGCAGSGAASGSGGADPSSATSPSPTGPALEGSITVFAAASLTQTFTELAARFEGENPGTTVALNFAGSSDLVTQITEGAPADVFASADDKNMAKLTDAALVDPAAPIGFATNVLEIAVPPANPAGITSFADLAAPGVKLVVCAPQVPCGAAAAAVEQAAGVTLSPVSEESSVTDVLGKVTSGEADAGLVYVTDVKAAGDAVKGIEFPESSGAVNTYPIAVVKDSKAADVAQAFVDYVAGPVGQGVLADAGFGVP

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
12 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
13 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
19 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
24 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
25 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
26 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
27 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
28 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
29 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
36 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
37 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
38 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
39 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
47 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
48 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
49 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
50 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
51 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
52 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
55 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
56 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
57 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
58 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
59 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
60 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
61 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
62 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
63 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
64 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
65 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
66 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
67 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
68 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
69 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
70 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
72 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
73 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
74 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
75 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
76 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
77 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
78 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere
79 2643221572 Leifsonia sp. Root60 Isolate Unclassified
80 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
81 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
82 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
83 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
84 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
85 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
86 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
87 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
88 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
89 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
90 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
91 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
92 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
93 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
94 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.26
Metatranscriptomes 0
Isolates 15.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.93
Bulb 0
Endosphere 18.52
Nodule 0
Rhizoplane 10.19
Rhizosphere 55.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000068 3300002773 Bacteria 68180
2 JGI25151J46595_10037931 3300003187 Bacteria 1801
3 rootH1_10036420 3300003316 Bacteria 1284
4 rootH2_10059861 3300003320 Bacteria 6539
5 Ga0065714_10086741 3300005288 Bacteria 2085
6 Ga0070674_100084311 3300005356 Bacteria 2279
7 Ga0070667_100160040 3300005367 Bacteria 1982
8 Ga0081455_10001423 3300005937 Bacteria 29572
9 Ga0075365_10068214 3300006038 Bacteria 2389
10 Ga0075368_10081324 3300006042 Bacteria 1318
11 Ga0075364_10098545 3300006051 Bacteria 1945
12 Ga0075364_10428581 3300006051 Bacteria 903
13 Ga0097621_100340730 3300006237 Bacteria 1331
14 Ga0068871_100067050 3300006358 Bacteria 2943
15 Ga0105243_10017842 3300009148 Bacteria 5369
16 Ga0105248_10470905 3300009177 Bacteria 1416
17 Ga0105246_10069017 3300011119 Bacteria 2481
18 Ga0157369_10020852 3300013105 Bacteria 7326
19 Ga0157374_10706019 3300013296 Bacteria 1022
20 Ga0157378_10341709 3300013297 Bacteria 1460
21 Ga0163162_10015277 3300013306 Bacteria 7499
22 Ga0157375_10080700 3300013308 Bacteria 3292
23 Ga0163163_10278656 3300014325 Bacteria 1724
24 Ga0157380_10144387 3300014326 Bacteria 2049
25 Ga0163161_10017469 3300017792 Bacteria 5020
26 Ga0207425_1002555 3300025245 Bacteria 6333
27 Ga0209759_1014749 3300025256 Bacteria 2050
28 Ga0209129_1000052 3300025258 Bacteria 265251
29 Ga0209025_1000895 3300025294 Bacteria 46371
30 Ga0209051_1033894 3300025303 Bacteria 1922
31 Ga0207697_10013947 3300025315 Bacteria 3346
32 Ga0207643_10020641 3300025908 Bacteria 3616
33 Ga0207709_10005772 3300025935 Bacteria 6993
34 Ga0207709_10102028 3300025935 Bacteria 1899
35 Ga0207691_10002435 3300025940 Bacteria 18208
36 Ga0207677_10228217 3300026023 Bacteria 1498
37 Ga0207428_10012975 3300027907 Bacteria 7300
38 Ga0307410_10020568 3300031852 Bacteria 4039
39 Ga0307407_10031948 3300031903 Bacteria 2856
40 Ga0307412_10395582 3300031911 Bacteria 1123
41 Ga0307412_10514199 3300031911 Bacteria 999
42 Ga0307409_100525735 3300031995 Bacteria 1156
43 Ga0307416_100221041 3300032002 Bacteria 1816
44 Ga0395899_0111987 3300037312 Bacteria 1961
45 Ga0395900_0074941 3300037418 Bacteria 3478
46 Ga0395900_0099231 3300037418 Bacteria 2992
47 Ga0395900_0111112 3300037418 Bacteria 2815
48 Ga0395898_0260659 3300037466 Bacteria 1653
49 Ga0395905_0618995 3300037471 Bacteria 985
50 Ga0395901_0294589 3300038443 Bacteria 1683
51 Ga0439436_0007815 3300041404 Bacteria 3287
52 Ga0439466_0004392 3300041411 Bacteria 5430
53 Ga0439433_0000437 3300041999 Bacteria 7631
54 Ga0439449_0011370 3300042007 Bacteria 3349
55 Ga0439457_002870 3300042014 Bacteria 4801
56 Ga0450920_007356 3300042122 Bacteria 1996
57 Ga0466965_0013511 3300044683 Bacteria 3853
58 Ga0466967_0232140 3300045976 Bacteria 1757
59 Ga0495580_0009639 3300046472 Bacteria 7584
60 Ga0495639_0071949 3300046475 Bacteria 1598
61 Ga0495633_0125610 3300046558 Bacteria 1187
62 Ga0495670_0024247 3300046691 Bacteria 2998
63 Ga0496100_0003306 3300048903 Bacteria 8387
64 Ga0496101_0003726 3300048904 Bacteria 9506
65 Ga0496102_0015125 3300048905 Bacteria 6719
66 Ga0496102_0035536 3300048905 Bacteria 4485
67 Ga0496102_0084114 3300048905 Bacteria 2936
68 Ga0496103_0008762 3300048906 Bacteria 6002
69 Ga0496106_0005978 3300048909 Bacteria 8994
70 Ga0496107_0002897 3300048910 Bacteria 11335
71 Ga0496110_0197454 3300048913 Bacteria 1827
72 Ga0496111_0142751 3300048914 Bacteria 1774
73 Ga0496112_0032086 3300048915 Bacteria 5098
74 Ga0496117_0000396 3300048920 Bacteria 74325
75 Ga0496117_0014530 3300048920 Bacteria 6777
76 Ga0496122_0005682 3300048925 Bacteria 14725
77 Ga0496122_0035600 3300048925 Bacteria 4045
78 Ga0496123_0017959 3300048926 Bacteria 5663
79 Ga0496123_0020460 3300048926 Bacteria 5175
80 Ga0501038_0048182 3300049574 Bacteria 3688
81 Ga0501043_0142218 3300049579 Bacteria 1878
82 nmdc:mga00v17_134233_c1 3300050491 Bacteria 1583
83 nmdc:mga0yw44_73141_c1 3300050492 Bacteria 2132
84 nmdc:mga0yw44_87055_c1 3300050492 Bacteria 1969
85 nmdc:mga06z11_55796_c1 3300050494 Bacteria 2041
86 nmdc:mga07m45_386809_c1 3300050496 Bacteria 812
87 Ga0500573_0021712 3300053140 Bacteria 3682
88 Ga0500573_0075040 3300053140 Bacteria 1925
89 Ga0500573_0097530 3300053140 Bacteria 1656
90 Ga0500573_0127787 3300053140 Bacteria 1410
91 Ga0500616_0000733 3300053153 Bacteria 37954
92 8057349370 8057345674 Bacteria 4160394
93 2643876514 2643221572 Bacteria 3614809
94 2644383569 2643221669 Bacteria 3611286
95 2812334433 2811994874 Bacteria 5367947
96 2844854543 2844852863 Bacteria 3849151
97 2857733415 2857729791 Bacteria 4040535
98 2870624465 2870622029 Bacteria 3643329
99 2895660689 2895660088 Bacteria 3782833
100 2897561893 2897561785 Bacteria 3256946
101 2919061407 2919059106 Bacteria 4991624
102 2919394348 2919391150 Bacteria 4884741
103 2928121620 2928121344 Bacteria 3972376
104 2945960776 2945956166 Bacteria 5110334
105 2946005040 2946003308 Bacteria 3857229
106 2966925647 2966924647 Bacteria 3268643
107 2984592125 2984592036 Bacteria 3670284
108 8056039157 8056037122 Bacteria 3854319
109 JGI25152J39213_1000068
110 JGI25151J46595_10037931
111 rootH1_10036420
112 rootH2_10059861
113 Ga0065714_10086741
114 Ga0070674_100084311
115 Ga0070667_100160040
116 Ga0081455_10001423
117 Ga0075365_10068214
118 Ga0075368_10081324
119 Ga0075364_10098545
120 Ga0075364_10428581
121 Ga0097621_100340730
122 Ga0068871_100067050
123 Ga0105243_10017842
124 Ga0105248_10470905
125 Ga0105246_10069017
126 Ga0157369_10020852
127 Ga0157374_10706019
128 Ga0157378_10341709
129 Ga0163162_10015277
130 Ga0157375_10080700
131 Ga0163163_10278656
132 Ga0157380_10144387
133 Ga0163161_10017469
134 Ga0207425_1002555
135 Ga0209759_1014749
136 Ga0209129_1000052
137 Ga0209025_1000895
138 Ga0209051_1033894
139 Ga0207697_10013947
140 Ga0207643_10020641
141 Ga0207709_10005772
142 Ga0207709_10102028
143 Ga0207691_10002435
144 Ga0207677_10228217
145 Ga0207428_10012975
146 Ga0307410_10020568
147 Ga0307407_10031948
148 Ga0307412_10395582
149 Ga0307412_10514199
150 Ga0307409_100525735
151 Ga0307416_100221041
152 Ga0395899_0111987
153 Ga0395900_0074941
154 Ga0395900_0099231
155 Ga0395900_0111112
156 Ga0395898_0260659
157 Ga0395905_0618995
158 Ga0395901_0294589
159 Ga0439436_0007815
160 Ga0439466_0004392
161 Ga0439433_0000437
162 Ga0439449_0011370
163 Ga0439457_002870
164 Ga0450920_007356
165 Ga0466965_0013511
166 Ga0466967_0232140
167 Ga0495580_0009639
168 Ga0495639_0071949
169 Ga0495633_0125610
170 Ga0495670_0024247
171 Ga0496100_0003306
172 Ga0496101_0003726
173 Ga0496102_0015125
174 Ga0496102_0035536
175 Ga0496102_0084114
176 Ga0496103_0008762
177 Ga0496106_0005978
178 Ga0496107_0002897
179 Ga0496110_0197454
180 Ga0496111_0142751
181 Ga0496112_0032086
182 Ga0496117_0000396
183 Ga0496117_0014530
184 Ga0496122_0005682
185 Ga0496122_0035600
186 Ga0496123_0017959
187 Ga0496123_0020460
188 Ga0501038_0048182
189 Ga0501043_0142218
190 nmdc:mga00v17_134233_c1
191 nmdc:mga0yw44_73141_c1
192 nmdc:mga0yw44_87055_c1
193 nmdc:mga06z11_55796_c1
194 nmdc:mga07m45_386809_c1
195 Ga0500573_0021712
196 Ga0500573_0075040
197 Ga0500573_0097530
198 Ga0500573_0127787
199 Ga0500616_0000733
200 8057349370
201 2643876514
202 2644383569
203 2812334433
204 2844854543
205 2857733415
206 2870624465
207 2895660689
208 2897561893
209 2919061407
210 2919394348
211 2928121620
212 2945960776
213 2946005040
214 2966925647
215 2984592125
216 8056039157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

56

275

0.95

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

61

267

0.9

PF12727

PBP_like

PBP superfamily domain

72

261

0.74

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

52

263

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.925 17 240
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.9017 17 240
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.872 20 240
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.8698 19 240
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.8364 20 240
ID Description Score Start End Superfamily
af_P9WGU3_42_110_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9921 22 89 3.40.190.10
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9668 20 85 3.40.190.10
af_P9WGU3_42_110_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.964 22 89 3.40.190.10
af_P37329_30_103_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9594 22 86 3.40.190.10
af_Q58586_37_116_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9425 19 82 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A654ZUM9-F1-model_v4 Molybdate-binding lipoprotein MODA 0.9733 101 240 GO:0015689
GO:0030973
AF-A0A654ZUM9-F1-model_v4 Molybdate-binding lipoprotein MODA 0.9599 101 240 GO:0015689
GO:0030973
AF-A0A2W4IQN3-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.951 56 240 GO:0015689
GO:0030973
AF-A0A7Z0GJE7-F1-model_v4 Molybdate transport system substrate-binding protein 0.9443 19 240 GO:0015689
GO:0030973
GO:0046872
AF-A0A4P5XH14-F1-model_v4 deleted 0.9425 23 240

Map