F050171

General Info

Members Datasets Scaffolds Average Seq Length
108 35 216 160

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0505619|Ga0453684_0505619_504_1049
Length 181
Sequence MAQKSSPNTSESEGNMRICVYPGSFDPFTVGHHDVLEHALAMFDCVYVSVLNNGMKHPVFSVDERVEMIQHMVDVEHMQKVVVGRFDGLLVDYVRSVGASYIIRGLRATMDFEYEFQINALNRHLAPDIDTVYFMARPEHSFLSSSGIREIGTMGGSIKGLVPESIESIIVDRLKKQTSDC

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
4 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
5 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
6 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
7 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
8 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
9 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
10 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
11 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
12 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
13 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
14 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
15 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
16 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
17 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
18 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
19 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
20 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
21 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
22 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
23 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
24 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
25 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
26 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
27 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
28 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
29 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
30 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
31 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
32 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
33 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
34 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
35 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.85
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 17.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0505619 3300044712 Bacteria 1337
2 rootH2_10238186 3300003320 Bacteria 1066
3 Ga0070711_100265553 3300005439 Bacteria 1352
4 Ga0068856_100363741 3300005614 Bacteria 1465
5 Ga0068859_100362224 3300005617 Bacteria 1545
6 Ga0097620_100362251 3300006931 Bacteria 1545
7 Ga0157378_10109123 3300013297 Bacteria 2535
8 Ga0207690_11288021 3300025932 Unclassified 611
9 Ga0265323_10000155 3300028653 Bacteria 40398
10 Ga0265338_10005566 3300028800 Bacteria 16387
11 Ga0265327_10000611 3300031251 Bacteria 59062
12 Ga0265327_10116220 3300031251 Bacteria 1273
13 Ga0265316_10000613 3300031344 Bacteria 39669
14 Ga0265316_10002396 3300031344 Bacteria 19512
15 Ga0265316_10016976 3300031344 Bacteria 6302
16 Ga0265316_10025172 3300031344 Bacteria 4970
17 Ga0316579_10005001 3300031691 Bacteria 5319
18 Ga0316579_10037065 3300031691 Bacteria 2251
19 Ga0316579_10250731 3300031691 Bacteria 856
20 Ga0265342_10457495 3300031712 Unclassified 654
21 Ga0316576_10002128 3300031727 Bacteria 11151
22 Ga0316576_10007294 3300031727 Bacteria 6947
23 Ga0316576_10293503 3300031727 Bacteria 1216
24 Ga0316578_10114791 3300031728 Unclassified 1618
25 Ga0316578_10272871 3300031728 Bacteria 1013
26 Ga0316577_10087136 3300031733 Bacteria 1747
27 Ga0316583_10180238 3300032133 Bacteria 735
28 Ga0316580_10042174 3300032139 Unclassified 1409
29 Ga0373932_0014361 3300035112 Bacteria 1990
30 Ga0316574_0021166 3300035398 Unclassified 3858
31 Ga0316574_0124828 3300035398 Bacteria 1654
32 Ga0316574_0548722 3300035398 Bacteria 717
33 Ga0316582_0017890 3300036647 Unclassified 4111
34 Ga0316582_0201465 3300036647 Unclassified 1358
35 Ga0316582_0567305 3300036647 Bacteria 782
36 Ga0316584_0003529 3300036712 Bacteria 10196
37 Ga0316584_0217594 3300036712 Bacteria 1404
38 Ga0395899_0000061 3300037312 Bacteria 212002
39 Ga0395900_0593891 3300037418 Bacteria 1048
40 Ga0400483_002155 3300039062 Bacteria 26328
41 Ga0400483_231109 3300039062 Bacteria 23656
42 Ga0451795_0526785 3300041456 Bacteria 4615
43 Ga0451795_1513795 3300041456 Unclassified 729
44 Ga0451855_1224742 3300041511 Unclassified 1135
45 Ga0451577_0000010 3300042876 Bacteria 616686
46 Ga0451577_0007361 3300042876 Bacteria 10807
47 Ga0451577_0008341 3300042876 Bacteria 10082
48 Ga0451577_0056663 3300042876 Unclassified 3496
49 Ga0451577_0105452 3300042876 Bacteria 2519
50 Ga0451577_0107776 3300042876 Bacteria 2490
51 Ga0451577_0108990 3300042876 Bacteria 2476
52 Ga0451577_0145859 3300042876 Bacteria 2128
53 Ga0451577_0152291 3300042876 Bacteria 2081
54 Ga0451577_0278427 3300042876 Bacteria 1515
55 Ga0451577_0570531 3300042876 Bacteria 1027
56 Ga0451577_0735885 3300042876 Unclassified 892
57 Ga0451577_0855942 3300042876 Bacteria 820
58 Ga0451577_0938739 3300042876 Unclassified 778
59 Ga0451577_1182334 3300042876 Bacteria 682
60 Ga0453683_0000083 3300044673 Bacteria 143013
61 Ga0453683_0001595 3300044673 Bacteria 19160
62 Ga0453683_0013863 3300044673 Bacteria 5243
63 Ga0453683_0015909 3300044673 Bacteria 4861
64 Ga0453683_0024110 3300044673 Bacteria 3875
65 Ga0453683_0025962 3300044673 Bacteria 3719
66 Ga0453683_0029737 3300044673 Bacteria 3453
67 Ga0453683_0116133 3300044673 Bacteria 1684
68 Ga0453683_0445025 3300044673 Bacteria 838
69 Ga0466963_0120743 3300044694 Bacteria 1803
70 Ga0453684_0000130 3300044712 Bacteria 331761
71 Ga0453684_0000349 3300044712 Bacteria 192484
72 Ga0453684_0000378 3300044712 Bacteria 183374
73 Ga0453684_0001319 3300044712 Bacteria 73298
74 Ga0453684_0003211 3300044712 Bacteria 37484
75 Ga0453684_0016896 3300044712 Bacteria 11355
76 Ga0453684_0061866 3300044712 Bacteria 4801
77 Ga0453684_0062619 3300044712 Unclassified 4763
78 Ga0453684_0064333 3300044712 Unclassified 4686
79 Ga0453684_0080241 3300044712 Bacteria 4075
80 Ga0453684_0081296 3300044712 Bacteria 4042
81 Ga0453684_0101611 3300044712 Bacteria 3517
82 Ga0453684_0117783 3300044712 Bacteria 3214
83 Ga0453684_0127980 3300044712 Bacteria 3053
84 Ga0453684_0151437 3300044712 Bacteria 2756
85 Ga0453684_0161700 3300044712 Unclassified 2648
86 Ga0453684_0205719 3300044712 Bacteria 2291
87 Ga0453684_0310722 3300044712 Unclassified 1789
88 Ga0453684_0345787 3300044712 Bacteria 1678
89 Ga0453684_0380881 3300044712 Bacteria 1584
90 Ga0453684_0457062 3300044712 Bacteria 1420
91 Ga0453684_0535284 3300044712 Bacteria 1292
92 Ga0453684_0558204 3300044712 Unclassified 1260
93 Ga0453684_0617101 3300044712 Unclassified 1187
94 Ga0451576_0000353 3300045051 Bacteria 110215
95 Ga0451576_0000378 3300045051 Bacteria 104355
96 Ga0451576_0002344 3300045051 Bacteria 28561
97 Ga0451576_0022728 3300045051 Bacteria 6794
98 Ga0451576_0169833 3300045051 Bacteria 2276
99 Ga0451576_0263014 3300045051 Bacteria 1803
100 Ga0451576_0266659 3300045051 Unclassified 1790
101 Ga0451576_0301139 3300045051 Bacteria 1677
102 Ga0451576_0325791 3300045051 Bacteria 1608
103 Ga0451576_0618248 3300045051 Bacteria 1138
104 Ga0451576_1012829 3300045051 Bacteria 870
105 Ga0451576_2208694 3300045051 Bacteria 565
106 Ga0466958_0450165 3300045836 Bacteria 834
107 Ga0495646_0504546 3300046680 Bacteria 621
108 Ga0495602_0812829 3300048088 Bacteria 627
109 Ga0453684_0505619
110 rootH2_10238186
111 Ga0070711_100265553
112 Ga0068856_100363741
113 Ga0068859_100362224
114 Ga0097620_100362251
115 Ga0157378_10109123
116 Ga0207690_11288021
117 Ga0265323_10000155
118 Ga0265338_10005566
119 Ga0265327_10000611
120 Ga0265327_10116220
121 Ga0265316_10000613
122 Ga0265316_10002396
123 Ga0265316_10016976
124 Ga0265316_10025172
125 Ga0316579_10005001
126 Ga0316579_10037065
127 Ga0316579_10250731
128 Ga0265342_10457495
129 Ga0316576_10002128
130 Ga0316576_10007294
131 Ga0316576_10293503
132 Ga0316578_10114791
133 Ga0316578_10272871
134 Ga0316577_10087136
135 Ga0316583_10180238
136 Ga0316580_10042174
137 Ga0373932_0014361
138 Ga0316574_0021166
139 Ga0316574_0124828
140 Ga0316574_0548722
141 Ga0316582_0017890
142 Ga0316582_0201465
143 Ga0316582_0567305
144 Ga0316584_0003529
145 Ga0316584_0217594
146 Ga0395899_0000061
147 Ga0395900_0593891
148 Ga0400483_002155
149 Ga0400483_231109
150 Ga0451795_0526785
151 Ga0451795_1513795
152 Ga0451855_1224742
153 Ga0451577_0000010
154 Ga0451577_0007361
155 Ga0451577_0008341
156 Ga0451577_0056663
157 Ga0451577_0105452
158 Ga0451577_0107776
159 Ga0451577_0108990
160 Ga0451577_0145859
161 Ga0451577_0152291
162 Ga0451577_0278427
163 Ga0451577_0570531
164 Ga0451577_0735885
165 Ga0451577_0855942
166 Ga0451577_0938739
167 Ga0451577_1182334
168 Ga0453683_0000083
169 Ga0453683_0001595
170 Ga0453683_0013863
171 Ga0453683_0015909
172 Ga0453683_0024110
173 Ga0453683_0025962
174 Ga0453683_0029737
175 Ga0453683_0116133
176 Ga0453683_0445025
177 Ga0466963_0120743
178 Ga0453684_0000130
179 Ga0453684_0000349
180 Ga0453684_0000378
181 Ga0453684_0001319
182 Ga0453684_0003211
183 Ga0453684_0016896
184 Ga0453684_0061866
185 Ga0453684_0062619
186 Ga0453684_0064333
187 Ga0453684_0080241
188 Ga0453684_0081296
189 Ga0453684_0101611
190 Ga0453684_0117783
191 Ga0453684_0127980
192 Ga0453684_0151437
193 Ga0453684_0161700
194 Ga0453684_0205719
195 Ga0453684_0310722
196 Ga0453684_0345787
197 Ga0453684_0380881
198 Ga0453684_0457062
199 Ga0453684_0535284
200 Ga0453684_0558204
201 Ga0453684_0617101
202 Ga0451576_0000353
203 Ga0451576_0000378
204 Ga0451576_0002344
205 Ga0451576_0022728
206 Ga0451576_0169833
207 Ga0451576_0263014
208 Ga0451576_0266659
209 Ga0451576_0301139
210 Ga0451576_0325791
211 Ga0451576_0618248
212 Ga0451576_1012829
213 Ga0451576_2208694
214 Ga0466958_0450165
215 Ga0495646_0504546
216 Ga0495602_0812829

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

20

151

0.98

PF08218

Citrate_ly_lig

Citrate lyase ligase C-terminal domain

24

179

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o0a-assembly1.cif.gz_B crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1) 0.9719 6 153
5h16-assembly1.cif.gz_D crystal structure of the complex of phosphopantetheine adenylyltransferase from acinetobacter baumannii with citrate at 2.3 a resolution. 0.9668 7 153
3nba-assembly2.cif.gz_B phosphopantetheine adenylyltranferase from mycobacterium tuberculosis in complex with adenosine-5'-[(alpha,beta)-methyleno]triphosphate (ampcpp) 0.9661 6 152
7yy8-assembly1.cif.gz_B-2 crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 12 0.9654 6 151
6g6v-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. 0.9653 6 153
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9605 6 153 3.40.50.620
4f3rC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9552 7 153 3.40.50.620
3nd7D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9491 5 153 3.40.50.620
4natB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9402 5 151 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9331 1 153 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1Y2PBI5-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9941 6 155 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A4R3KTT7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9939 4 153 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A0R2RUD5-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9935 6 151 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A7C7FMZ9-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.993 5 155 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A2A5FK01-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9929 6 154 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Map