F049289

General Info

Members Datasets Scaffolds Average Seq Length
108 75 104 264

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10042401|Ga0265318_100424012
Length 297
Sequence MNANPESKAGISKPGSATPAIEVEELECRYGDTVVLSGITFAVRAGELFFVIGGSGCGKTTLLRHLIGLMKPAKGTVRYHGENFTNENLAARRQLLKTFGVLYQSSALWSSMTLRENIALPLEEYTTLNRREREEIVALKLAQVGLAGFEDYFPAELSGGMRKRAGLARALALDPRIVFFDEPSAGLDPVLSRKLDELILQIRETLGTTMVIVSHELASIYALADRVIMLDHDARGIIAEGRPRDLAATSNDPRVQEFLTRRGEEVGRHEPAVRHAGRRHRPGKTLDVASVRSVHSF

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
13 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
14 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
15 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
16 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
19 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
26 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
27 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
28 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
29 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
30 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
31 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
32 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
33 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
34 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
35 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
36 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
40 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
41 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
44 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
45 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
46 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
47 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
48 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
51 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
52 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
53 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
54 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
55 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
61 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
62 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
63 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
64 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
70 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
71 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
72 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
73 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
74 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
75 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.44
Metatranscriptomes 1.85
Isolates 3.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0
Rhizoplane 2.78
Rhizosphere 87.04
Stem 0
Stem Tuber 0
Unclassified 9.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000739 3300003320 Bacteria 27780
2 rootL2_10027190 3300003322 Bacteria 6328
3 rootH1_10084697 3300003323 Bacteria 3773
4 Ga0070683_100070224 3300005329 Bacteria 3267
5 Ga0070713_100007890 3300005436 Bacteria 7511
6 Ga0070713_100241246 3300005436 Bacteria 1646
7 Ga0070713_100510750 3300005436 Bacteria 1135
8 Ga0070678_100033293 3300005456 Bacteria 3577
9 Ga0070681_10099454 3300005458 Bacteria 2855
10 Ga0068856_100015882 3300005614 Bacteria 7279
11 Ga0070717_10000324 3300006028 Bacteria 31087
12 Ga0070712_100611968 3300006175 Bacteria 923
13 Ga0068871_100536039 3300006358 Bacteria 1059
14 Ga0075434_100230570 3300006871 Bacteria 1871
15 Ga0075436_100112203 3300006914 Bacteria 1903
16 Ga0114129_10428483 3300009147 Bacteria 1738
17 Ga0157369_10487503 3300013105 Bacteria 1276
18 Ga0163163_10752447 3300014325 Bacteria 1038
19 Ga0197907_11332468 3300020069 Bacteria 3288
20 Ga0224712_10000750 3300022467 Bacteria 6767
21 Ga0207707_10140728 3300025912 Bacteria 2110
22 Ga0207700_10013279 3300025928 Bacteria 5351
23 Ga0207700_10016172 3300025928 Bacteria 4948
24 Ga0207700_10074441 3300025928 Bacteria 2627
25 Ga0207708_10394907 3300026075 Bacteria 1143
26 Ga0207702_10002456 3300026078 Bacteria 17546
27 Ga0207702_10324611 3300026078 Bacteria 1467
28 Ga0265319_1008761 3300028563 Bacteria 4392
29 Ga0265319_1030082 3300028563 Bacteria 1901
30 Ga0265334_10002773 3300028573 Bacteria 8077
31 Ga0265318_10023241 3300028577 Bacteria 2472
32 Ga0265318_10038140 3300028577 Bacteria 1838
33 Ga0265318_10042401 3300028577 Bacteria 1727
34 Ga0265323_10000048 3300028653 Bacteria 65493
35 Ga0265323_10000224 3300028653 Bacteria 33270
36 Ga0265323_10004139 3300028653 Bacteria 6287
37 Ga0265323_10035780 3300028653 Bacteria 1829
38 Ga0265323_10051139 3300028653 Bacteria 1467
39 Ga0265322_10000168 3300028654 Bacteria 30155
40 Ga0265322_10000276 3300028654 Bacteria 21779
41 Ga0265322_10031513 3300028654 Bacteria 1513
42 Ga0265338_10026515 3300028800 Bacteria 5842
43 Ga0265330_10003727 3300031235 Bacteria 7881
44 Ga0265330_10011424 3300031235 Bacteria 4166
45 Ga0265328_10004529 3300031239 Bacteria 6031
46 Ga0265328_10143428 3300031239 Bacteria 896
47 Ga0265320_10004968 3300031240 Bacteria 8623
48 Ga0265329_10031079 3300031242 Bacteria 1737
49 Ga0265339_10059588 3300031249 Bacteria 2058
50 Ga0265331_10018676 3300031250 Bacteria 3589
51 Ga0265327_10000291 3300031251 Bacteria 98460
52 Ga0265316_10001006 3300031344 Bacteria 30615
53 Ga0265316_10006499 3300031344 Bacteria 11157
54 Ga0265316_10009533 3300031344 Bacteria 8933
55 Ga0265316_10063489 3300031344 Bacteria 2864
56 Ga0265316_10140290 3300031344 Bacteria 1816
57 Ga0265316_10420783 3300031344 Bacteria 960
58 Ga0265313_10001720 3300031595 Bacteria 20171
59 Ga0307508_10000039 3300031616 Bacteria 149732
60 Ga0316575_10031744 3300031665 Bacteria 2068
61 Ga0265314_10022181 3300031711 Bacteria 4867
62 Ga0265342_10002777 3300031712 Bacteria 14829
63 Ga0265342_10003957 3300031712 Bacteria 11871
64 Ga0265342_10014020 3300031712 Bacteria 5337
65 Ga0265342_10070511 3300031712 Bacteria 2039
66 Ga0316576_10090102 3300031727 Bacteria 2284
67 Ga0316576_10137147 3300031727 Bacteria 1841
68 Ga0316576_10152983 3300031727 Bacteria 1739
69 Ga0316578_10177822 3300031728 Bacteria 1282
70 Ga0316585_10019534 3300032137 Bacteria 2067
71 Ga0316574_0031213 3300035398 Bacteria 3231
72 Ga0316582_0264478 3300036647 Bacteria 1179
73 Ga0395905_0000016 3300037471 Bacteria 382308
74 Ga0395905_0004294 3300037471 Bacteria 14861
75 Ga0395905_0319293 3300037471 Bacteria 1443
76 Ga0436360_0109729 3300039438 Bacteria 5054
77 Ga0436363_0277501 3300039450 Bacteria 1653
78 Ga0436362_0451702 3300039453 Unclassified 1027
79 Ga0439445_0014697 3300042004 Bacteria 1909
80 Ga0451577_0000059 3300042876 Bacteria 271425
81 Ga0453683_0230041 3300044673 Bacteria 1180
82 Ga0453684_0000019 3300044712 Bacteria 908702
83 Ga0466959_0017452 3300045049 Bacteria 5262
84 Ga0451576_0001627 3300045051 Bacteria 37650
85 Ga0451576_0198441 3300045051 Bacteria 2096
86 Ga0451576_0789333 3300045051 Bacteria 997
87 Ga0466967_0065914 3300045976 Bacteria 3225
88 Ga0495600_0308923 3300046809 Bacteria 996
89 Ga0496109_0042462 3300048912 Bacteria 4119
90 Ga0496110_0037591 3300048913 Bacteria 4208
91 Ga0496110_0490926 3300048913 Bacteria 1118
92 Ga0496126_0180959 3300048929 Bacteria 1791
93 Ga0501034_0012761 3300049571 Bacteria 8666
94 Ga0501036_0149327 3300049572 Bacteria 1971
95 Ga0501043_0018056 3300049579 Bacteria 5533
96 Ga0501046_0003145 3300049580 Bacteria 15247
97 Ga0501046_0311279 3300049580 Bacteria 1148
98 Ga0501035_0009029 3300049822 Bacteria 9272
99 Ga0501044_0003527 3300049823 Bacteria 17613
100 nmdc:mga06r32_569926_c1 3300050510 Bacteria 1105
101 nmdc:mga0n895_161610_c1 3300050512 Bacteria 2271
102 nmdc:mga0n895_841007_c1 3300050512 Bacteria 906
103 nmdc:mga0rr50_571013_c1 3300050513 Bacteria 963
104 Ga0500568_0003237 3300053139 Bacteria 9208

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0198441 Ga0451576_0198441_1181_1972 232
2 3300050510 nmdc:mga06r32_569926_c1 nmdc:mga06r32_569926_c1_326_1045 239
3 3300022467 Ga0224712_10000750 Ga0224712_100007506 241
4 3300039438 Ga0436360_0109729 Ga0436360_0109729_4265_5014 241
5 3300050512 nmdc:mga0n895_841007_c1 nmdc:mga0n895_841007_c1_141_875 243
6 3300048913 Ga0496110_0037591 Ga0496110_0037591_1861_2604 247
7 3300026075 Ga0207708_10394907 Ga0207708_103949072 249
8 3300048912 Ga0496109_0042462 Ga0496109_0042462_3070_3822 250
9 3300048913 Ga0496110_0490926 Ga0496110_0490926_205_957 250
10 3300005436 Ga0070713_100007890 Ga0070713_1000078906 251
11 3300025928 Ga0207700_10016172 Ga0207700_100161725 251
12 3300005456 Ga0070678_100033293 Ga0070678_1000332934 252
13 3300037471 Ga0395905_0004294 Ga0395905_0004294_2874_3632 252
14 3300037471 Ga0395905_0000016 Ga0395905_0000016_144930_145691 253
15 3300045049 Ga0466959_0017452 Ga0466959_0017452_453_1214 253
16 3300048929 Ga0496126_0180959 Ga0496126_0180959_40_831 253
17 3300028577 Ga0265318_10023241 Ga0265318_100232412 254
18 3300028653 Ga0265323_10035780 Ga0265323_100357802 254
19 3300031727 Ga0316576_10152983 Ga0316576_101529832 254
20 iso_pu_bacteria 2786546940 2788435277 254
21 3300005329 Ga0070683_100070224 Ga0070683_1000702242 255
22 3300005458 Ga0070681_10099454 Ga0070681_100994542 255
23 3300006358 Ga0068871_100536039 Ga0068871_1005360392 255
24 3300013105 Ga0157369_10487503 Ga0157369_104875031 255
25 3300025912 Ga0207707_10140728 Ga0207707_101407282 255
26 3300026078 Ga0207702_10324611 Ga0207702_103246112 255
27 3300031727 Ga0316576_10090102 Ga0316576_100901022 255
28 3300049571 Ga0501034_0012761 Ga0501034_0012761_3018_3791 255
29 3300003322 rootL2_10027190 rootL2_100271904 256
30 3300006028 Ga0070717_10000324 Ga0070717_100003249 256
31 3300014325 Ga0163163_10752447 Ga0163163_107524471 256
32 3300028563 Ga0265319_1008761 Ga0265319_10087614 256
33 3300028573 Ga0265334_10002773 Ga0265334_100027738 256
34 3300028653 Ga0265323_10000048 Ga0265323_1000004859 256
35 3300028653 Ga0265323_10051139 Ga0265323_100511392 256
36 3300028654 Ga0265322_10000276 Ga0265322_1000027616 256
37 3300028800 Ga0265338_10026515 Ga0265338_100265152 256
38 3300031235 Ga0265330_10003727 Ga0265330_100037275 256
39 3300031239 Ga0265328_10004529 Ga0265328_100045296 256
40 3300031249 Ga0265339_10059588 Ga0265339_100595881 256
41 3300031250 Ga0265331_10018676 Ga0265331_100186762 256
42 3300031251 Ga0265327_10000291 Ga0265327_1000029141 256
43 3300031344 Ga0265316_10001006 Ga0265316_1000100622 256
44 3300031344 Ga0265316_10009533 Ga0265316_1000953312 256
45 3300031344 Ga0265316_10063489 Ga0265316_100634893 256
46 3300031616 Ga0307508_10000039 Ga0307508_1000003938 256
47 3300031712 Ga0265342_10003957 Ga0265342_100039572 256
48 3300031712 Ga0265342_10070511 Ga0265342_100705112 256
49 3300037471 Ga0395905_0319293 Ga0395905_0319293_80_859 256
50 3300039450 Ga0436363_0277501 Ga0436363_0277501_756_1547 256
51 3300039453 Ga0436362_0451702 Ga0436362_0451702_192_998 256
52 3300042004 Ga0439445_0014697 Ga0439445_0014697_937_1725 256
53 3300042876 Ga0451577_0000059 Ga0451577_0000059_235524_236327 256
54 3300044673 Ga0453683_0230041 Ga0453683_0230041_185_976 256
55 3300045051 Ga0451576_0001627 Ga0451576_0001627_21634_22443 256
56 3300045051 Ga0451576_0789333 Ga0451576_0789333_36_824 256
57 3300046809 Ga0495600_0308923 Ga0495600_0308923_11_805 256
58 3300049572 Ga0501036_0149327 Ga0501036_0149327_362_1165 256
59 3300049579 Ga0501043_0018056 Ga0501043_0018056_2190_2993 256
60 3300049580 Ga0501046_0003145 Ga0501046_0003145_11835_12638 256
61 3300049580 Ga0501046_0311279 Ga0501046_0311279_61_864 256
62 3300049822 Ga0501035_0009029 Ga0501035_0009029_6314_7117 256
63 3300049823 Ga0501044_0003527 Ga0501044_0003527_10469_11272 256
64 3300053139 Ga0500568_0003237 Ga0500568_0003237_2236_3045 256
65 iso_pu_bacteria 641228493 641334747 256
66 iso_pu_bacteria 643348555 643390758 256
67 3300044712 Ga0453684_0000019 Ga0453684_0000019_328431_329222 257
68 3300003320 rootH2_10000739 rootH2_1000073914 258
69 3300003323 rootH1_10084697 rootH1_100846974 258
70 3300005436 Ga0070713_100241246 Ga0070713_1002412461 258
71 3300005436 Ga0070713_100510750 Ga0070713_1005107501 258
72 3300005614 Ga0068856_100015882 Ga0068856_1000158823 258
73 3300006175 Ga0070712_100611968 Ga0070712_1006119681 258
74 3300006871 Ga0075434_100230570 Ga0075434_1002305702 258
75 3300006914 Ga0075436_100112203 Ga0075436_1001122032 258
76 3300009147 Ga0114129_10428483 Ga0114129_104284832 258
77 3300020069 Ga0197907_11332468 Ga0197907_113324682 258
78 3300025928 Ga0207700_10013279 Ga0207700_100132796 258
79 3300025928 Ga0207700_10074441 Ga0207700_100744412 258
80 3300026078 Ga0207702_10002456 Ga0207702_100024567 258
81 3300028563 Ga0265319_1030082 Ga0265319_10300821 258
82 3300028577 Ga0265318_10038140 Ga0265318_100381402 258
83 3300028577 Ga0265318_10042401 Ga0265318_100424012 258
84 3300028653 Ga0265323_10000224 Ga0265323_100002245 258
85 3300028653 Ga0265323_10004139 Ga0265323_100041394 258
86 3300028654 Ga0265322_10000168 Ga0265322_100001687 258
87 3300028654 Ga0265322_10031513 Ga0265322_100315132 258
88 3300031235 Ga0265330_10011424 Ga0265330_100114245 258
89 3300031239 Ga0265328_10143428 Ga0265328_101434281 258
90 3300031240 Ga0265320_10004968 Ga0265320_100049685 258
91 3300031242 Ga0265329_10031079 Ga0265329_100310792 258
92 3300031344 Ga0265316_10006499 Ga0265316_1000649912 258
93 3300031344 Ga0265316_10140290 Ga0265316_101402902 258
94 3300031344 Ga0265316_10420783 Ga0265316_104207831 258
95 3300031595 Ga0265313_10001720 Ga0265313_100017208 258
96 3300031665 Ga0316575_10031744 Ga0316575_100317442 258
97 3300031711 Ga0265314_10022181 Ga0265314_100221814 258
98 3300031712 Ga0265342_10002777 Ga0265342_100027774 258
99 3300031712 Ga0265342_10014020 Ga0265342_100140203 258
100 3300031727 Ga0316576_10137147 Ga0316576_101371472 258
101 3300031728 Ga0316578_10177822 Ga0316578_101778221 258
102 3300032137 Ga0316585_10019534 Ga0316585_100195342 258
103 3300035398 Ga0316574_0031213 Ga0316574_0031213_781_1581 258
104 3300036647 Ga0316582_0264478 Ga0316582_0264478_362_1162 258
105 3300045976 Ga0466967_0065914 Ga0466967_0065914_433_1209 258
106 3300050512 nmdc:mga0n895_161610_c1 nmdc:mga0n895_161610_c1_749_1567 258
107 3300050513 nmdc:mga0rr50_571013_c1 nmdc:mga0rr50_571013_c1_19_843 258
108 iso_pu_bacteria 2909399089 2909401782 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

36

185

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9691 8 249
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9675 8 249
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.965 8 249
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9633 11 250
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.958 9 249
ID Description Score Start End Superfamily
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9769 11 249 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9707 26 249 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9554 11 227 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9549 9 232 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9529 8 258 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A355FUD0-F1-model_v4 ABC transporter ATP-binding protein 0.9831 11 236 GO:0005524
GO:0016887
AF-A0A7X9Y728-F1-model_v4 ATP-binding cassette domain-containing protein 0.9764 5 249 GO:0005524
GO:0016887
AF-A0A2N7JK81-F1-model_v4 ABC transporter ATP-binding protein 0.9743 8 250 GO:0005524
GO:0016887
AF-A0A7U3VV78-F1-model_v4 deleted 0.9735 8 249
AF-A0A6B2U183-F1-model_v4 deleted 0.9722 11 251

Feature Viewer

pLDDT pTM Quality
91.6 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map