F048453

General Info

Members Datasets Scaffolds Average Seq Length
108 87 108 134

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10378878|Ga0111539_103788782
Length 159
Sequence MRQSIRSLGKRSRTLNVLHPSMSDSAPRLLYCHCQYAQVVPKDVKEVVLRRLCESGVAFEAVADLCEMAARRDPALQRLAACGGLKIAACFPRAVKGLFHQANADLPSDAAEVLNMRVQSADDVCAALLSSELKPNLPARPTVQPLDQRMDAANQISAG

Samples

Sample ID Description Type Environment
1 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
61 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
62 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
78 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
79 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
80 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
84 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
85 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
86 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
87 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.63
Nodule 0
Rhizoplane 0.93
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10015329 3300003791 Unclassified 2508
2 Ga0070658_10014373 3300005327 Bacteria 6351
3 Ga0068869_100837937 3300005334 Unclassified 793
4 Ga0070666_11012524 3300005335 Bacteria 616
5 Ga0070660_100148917 3300005339 Unclassified 1881
6 Ga0070668_100534025 3300005347 Bacteria 1019
7 Ga0070701_10428198 3300005438 Unclassified 844
8 Ga0070701_10717488 3300005438 Unclassified 674
9 Ga0070694_100259605 3300005444 Bacteria 1317
10 Ga0070708_101214740 3300005445 Bacteria 705
11 Ga0070662_101841979 3300005457 Unclassified 523
12 Ga0070685_10793559 3300005466 Unclassified 697
13 Ga0070679_100490418 3300005530 Unclassified 1173
14 Ga0070684_100646900 3300005535 Unclassified 984
15 Ga0068853_100000060 3300005539 Bacteria 78205
16 Ga0070686_100036744 3300005544 Bacteria 3035
17 Ga0070665_100443193 3300005548 Bacteria 1308
18 Ga0068855_100442140 3300005563 Bacteria 1420
19 Ga0068852_100015746 3300005616 Bacteria 5878
20 Ga0068859_100473083 3300005617 Bacteria 1349
21 Ga0068859_100796293 3300005617 Bacteria 1033
22 Ga0068859_101039077 3300005617 Bacteria 900
23 Ga0068859_102780977 3300005617 Unclassified 537
24 Ga0068864_102711087 3300005618 Unclassified 501
25 Ga0068851_10186611 3300005834 Bacteria 1151
26 Ga0068863_100502080 3300005841 Unclassified 1195
27 Ga0068858_100036273 3300005842 Bacteria 4572
28 Ga0068858_100049523 3300005842 Bacteria 3891
29 Ga0068858_100644745 3300005842 Bacteria 1029
30 Ga0068860_101088683 3300005843 Bacteria 818
31 Ga0068860_101701071 3300005843 Unclassified 653
32 Ga0068862_101992790 3300005844 Unclassified 591
33 Ga0075433_10300234 3300006852 Bacteria 1422
34 Ga0075434_102262103 3300006871 Unclassified 547
35 Ga0097620_100473066 3300006931 Bacteria 1349
36 Ga0097620_100796302 3300006931 Bacteria 1033
37 Ga0097620_101038957 3300006931 Bacteria 900
38 Ga0097620_102780234 3300006931 Unclassified 537
39 Ga0075435_100543640 3300007076 Bacteria 1006
40 Ga0105240_10014835 3300009093 Bacteria 10621
41 Ga0111539_10171957 3300009094 Unclassified 2531
42 Ga0111539_10378878 3300009094 Unclassified 1647
43 Ga0105237_10002055 3300009545 Bacteria 25558
44 Ga0105238_11085267 3300009551 Bacteria 823
45 Ga0105238_12927749 3300009551 Unclassified 513
46 Ga0105249_10724981 3300009553 Bacteria 1055
47 Ga0105249_11078362 3300009553 Bacteria 873
48 Ga0099796_10146458 3300010159 Unclassified 927
49 Ga0105239_10056573 3300010375 Bacteria 4302
50 Ga0105239_10255611 3300010375 Archaea 1968
51 Ga0105239_10453510 3300010375 Bacteria 1455
52 Ga0157371_10977855 3300013102 Unclassified 645
53 Ga0157370_10755176 3300013104 Bacteria 886
54 Ga0157374_10539265 3300013296 Bacteria 1174
55 Ga0163162_10764151 3300013306 Bacteria 1085
56 Ga0157375_11340313 3300013308 Bacteria 842
57 Ga0163163_10023280 3300014325 Bacteria 5876
58 Ga0157380_11619344 3300014326 Bacteria 703
59 Ga0209050_1002359 3300025298 Bacteria 16471
60 Ga0207680_10931315 3300025903 Bacteria 623
61 Ga0207705_10055036 3300025909 Bacteria 2868
62 Ga0207695_10000270 3300025913 Bacteria 130172
63 Ga0207695_10078160 3300025913 Bacteria 3358
64 Ga0207657_10422444 3300025919 Bacteria 1048
65 Ga0207652_10865817 3300025921 Unclassified 800
66 Ga0207644_10081404 3300025931 Unclassified 2393
67 Ga0207667_10001093 3300025949 Bacteria 34363
68 Ga0207667_10382932 3300025949 Bacteria 1433
69 Ga0207668_10352055 3300025972 Bacteria 1232
70 Ga0207703_10012350 3300026035 Bacteria 6658
71 Ga0207703_10032117 3300026035 Bacteria 4155
72 Ga0207639_10000087 3300026041 Bacteria 79236
73 Ga0207676_10035929 3300026095 Bacteria 3766
74 Ga0207698_10055094 3300026142 Unclassified 3062
75 Ga0268266_10417545 3300028379 Bacteria 1271
76 Ga0268264_11399893 3300028381 Unclassified 710
77 Ga0265338_10170885 3300028800 Bacteria 1667
78 Ga0265332_10013487 3300031238 Unclassified 3622
79 Ga0265328_10055972 3300031239 Unclassified 1447
80 Ga0265329_10001171 3300031242 Bacteria 12896
81 Ga0265327_10326119 3300031251 Unclassified 673
82 Ga0265316_10088512 3300031344 Unclassified 2364
83 Ga0265314_10000792 3300031711 Bacteria 37540
84 Ga0307405_10424464 3300031731 Unclassified 1047
85 Ga0307410_10198239 3300031852 Unclassified 1531
86 Ga0307406_10661745 3300031901 Unclassified 868
87 Ga0307412_10033007 3300031911 Bacteria 3286
88 Ga0307409_100041202 3300031995 Unclassified 3447
89 Ga0307416_100730959 3300032002 Bacteria 1081
90 Ga0307411_10479559 3300032005 Unclassified 1047
91 Ga0373927_0995639 3300035695 Unclassified 553
92 Ga0451793_1294167 3300041452 Unclassified 639
93 Ga0451576_1226384 3300045051 Unclassified 783
94 Ga0451576_1310279 3300045051 Bacteria 755
95 Ga0451576_2115560 3300045051 Unclassified 579
96 Ga0495580_0921169 3300046472 Unclassified 561
97 Ga0495643_0000111 3300046522 Bacteria 135372
98 Ga0495625_0802918 3300046660 Unclassified 547
99 Ga0495635_0899755 3300046663 Unclassified 567
100 Ga0495658_0025147 3300046683 Unclassified 3180
101 Ga0495684_0440206 3300047471 Unclassified 908
102 Ga0501044_1373178 3300049823 Unclassified 572
103 nmdc:mga07m45_157832_c1 3300050496 Unclassified 1316
104 nmdc:mga09592_1594551_c1 3300050508 Unclassified 529
105 nmdc:mga08y16_389349_c1 3300050511 Unclassified 1428
106 nmdc:mga08y16_5226_c1 3300050511 Bacteria 13559
107 Ga0500568_0288254 3300053139 Unclassified 596
108 Ga0500616_0004356 3300053153 Bacteria 10128

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_157832_c1 nmdc:mga07m45_157832_c1_730_1200 120
2 3300005445 Ga0070708_101214740 Ga0070708_1012147401 123
3 3300006852 Ga0075433_10300234 Ga0075433_103002343 124
4 3300005334 Ga0068869_100837937 Ga0068869_1008379372 126
5 3300005843 Ga0068860_101088683 Ga0068860_1010886832 126
6 3300045051 Ga0451576_1310279 Ga0451576_1310279_43_438 126
7 3300050511 nmdc:mga08y16_5226_c1 nmdc:mga08y16_5226_c1_10774_11163 126
8 3300005438 Ga0070701_10717488 Ga0070701_107174881 127
9 3300005444 Ga0070694_100259605 Ga0070694_1002596052 127
10 3300005466 Ga0070685_10793559 Ga0070685_107935591 127
11 3300005530 Ga0070679_100490418 Ga0070679_1004904182 127
12 3300005535 Ga0070684_100646900 Ga0070684_1006469002 127
13 3300005539 Ga0068853_100000060 Ga0068853_10000006039 127
14 3300005544 Ga0070686_100036744 Ga0070686_1000367443 127
15 3300005617 Ga0068859_100473083 Ga0068859_1004730832 127
16 3300005617 Ga0068859_102780977 Ga0068859_1027809771 127
17 3300005618 Ga0068864_102711087 Ga0068864_1027110872 127
18 3300005841 Ga0068863_100502080 Ga0068863_1005020802 127
19 3300005844 Ga0068862_101992790 Ga0068862_1019927902 127
20 3300006931 Ga0097620_100473066 Ga0097620_1004730662 127
21 3300006931 Ga0097620_102780234 Ga0097620_1027802341 127
22 3300007076 Ga0075435_100543640 Ga0075435_1005436402 127
23 3300009093 Ga0105240_10014835 Ga0105240_100148358 127
24 3300009551 Ga0105238_12927749 Ga0105238_129277492 127
25 3300013102 Ga0157371_10977855 Ga0157371_109778551 127
26 3300014325 Ga0163163_10023280 Ga0163163_100232803 127
27 3300025913 Ga0207695_10078160 Ga0207695_100781603 127
28 3300025921 Ga0207652_10865817 Ga0207652_108658172 127
29 3300026041 Ga0207639_10000087 Ga0207639_1000008734 127
30 3300026095 Ga0207676_10035929 Ga0207676_100359294 127
31 3300028800 Ga0265338_10170885 Ga0265338_101708851 127
32 3300031731 Ga0307405_10424464 Ga0307405_104244642 127
33 3300031852 Ga0307410_10198239 Ga0307410_101982392 127
34 3300031901 Ga0307406_10661745 Ga0307406_106617452 127
35 3300031911 Ga0307412_10033007 Ga0307412_100330072 127
36 3300031995 Ga0307409_100041202 Ga0307409_1000412022 127
37 3300032002 Ga0307416_100730959 Ga0307416_1007309592 127
38 3300032005 Ga0307411_10479559 Ga0307411_104795592 127
39 3300041452 Ga0451793_1294167 Ga0451793_1294167_223_621 127
40 3300045051 Ga0451576_1226384 Ga0451576_1226384_183_575 127
41 3300046472 Ga0495580_0921169 Ga0495580_0921169_39_431 127
42 3300046663 Ga0495635_0899755 Ga0495635_0899755_113_529 127
43 3300046683 Ga0495658_0025147 Ga0495658_0025147_252_647 127
44 3300047471 Ga0495684_0440206 Ga0495684_0440206_358_747 127
45 3300005335 Ga0070666_11012524 Ga0070666_110125242 128
46 3300005347 Ga0070668_100534025 Ga0070668_1005340252 128
47 3300005438 Ga0070701_10428198 Ga0070701_104281981 128
48 3300005457 Ga0070662_101841979 Ga0070662_1018419791 128
49 3300005617 Ga0068859_100796293 Ga0068859_1007962932 128
50 3300005842 Ga0068858_100644745 Ga0068858_1006447452 128
51 3300006871 Ga0075434_102262103 Ga0075434_1022621032 128
52 3300006931 Ga0097620_100796302 Ga0097620_1007963022 128
53 3300009551 Ga0105238_11085267 Ga0105238_110852671 128
54 3300009553 Ga0105249_10724981 Ga0105249_107249812 128
55 3300010159 Ga0099796_10146458 Ga0099796_101464581 128
56 3300010375 Ga0105239_10255611 Ga0105239_102556112 128
57 3300013306 Ga0163162_10764151 Ga0163162_107641511 128
58 3300013308 Ga0157375_11340313 Ga0157375_113403132 128
59 3300014326 Ga0157380_11619344 Ga0157380_116193441 128
60 3300025903 Ga0207680_10931315 Ga0207680_109313151 128
61 3300025931 Ga0207644_10081404 Ga0207644_100814043 128
62 3300025972 Ga0207668_10352055 Ga0207668_103520553 128
63 3300031238 Ga0265332_10013487 Ga0265332_100134875 128
64 3300031239 Ga0265328_10055972 Ga0265328_100559722 128
65 3300031242 Ga0265329_10001171 Ga0265329_100011712 128
66 3300031344 Ga0265316_10088512 Ga0265316_100885122 128
67 3300031711 Ga0265314_10000792 Ga0265314_1000079217 128
68 3300045051 Ga0451576_2115560 Ga0451576_2115560_81_488 128
69 3300050508 nmdc:mga09592_1594551_c1 nmdc:mga09592_1594551_c1_40_426 128
70 3300003791 Ga0055530_10015329 Ga0055530_100153292 129
71 3300005327 Ga0070658_10014373 Ga0070658_100143734 129
72 3300005339 Ga0070660_100148917 Ga0070660_1001489173 129
73 3300005548 Ga0070665_100443193 Ga0070665_1004431932 129
74 3300005563 Ga0068855_100442140 Ga0068855_1004421401 129
75 3300005616 Ga0068852_100015746 Ga0068852_1000157462 129
76 3300005617 Ga0068859_101039077 Ga0068859_1010390771 129
77 3300005834 Ga0068851_10186611 Ga0068851_101866112 129
78 3300005842 Ga0068858_100036273 Ga0068858_1000362734 129
79 3300005842 Ga0068858_100049523 Ga0068858_1000495234 129
80 3300005843 Ga0068860_101701071 Ga0068860_1017010711 129
81 3300006931 Ga0097620_101038957 Ga0097620_1010389571 129
82 3300009094 Ga0111539_10171957 Ga0111539_101719571 129
83 3300009094 Ga0111539_10378878 Ga0111539_103788782 129
84 3300009545 Ga0105237_10002055 Ga0105237_1000205515 129
85 3300009553 Ga0105249_11078362 Ga0105249_110783621 129
86 3300010375 Ga0105239_10056573 Ga0105239_100565735 129
87 3300010375 Ga0105239_10453510 Ga0105239_104535102 129
88 3300013104 Ga0157370_10755176 Ga0157370_107551762 129
89 3300013296 Ga0157374_10539265 Ga0157374_105392652 129
90 3300025298 Ga0209050_1002359 Ga0209050_10023594 129
91 3300025909 Ga0207705_10055036 Ga0207705_100550363 129
92 3300025913 Ga0207695_10000270 Ga0207695_100002705 129
93 3300025919 Ga0207657_10422444 Ga0207657_104224442 129
94 3300025949 Ga0207667_10001093 Ga0207667_100010934 129
95 3300025949 Ga0207667_10382932 Ga0207667_103829322 129
96 3300026035 Ga0207703_10012350 Ga0207703_100123505 129
97 3300026035 Ga0207703_10032117 Ga0207703_100321174 129
98 3300026142 Ga0207698_10055094 Ga0207698_100550942 129
99 3300028379 Ga0268266_10417545 Ga0268266_104175452 129
100 3300028381 Ga0268264_11399893 Ga0268264_113998931 129
101 3300031251 Ga0265327_10326119 Ga0265327_103261192 129
102 3300035695 Ga0373927_0995639 Ga0373927_0995639_55_447 129
103 3300046522 Ga0495643_0000111 Ga0495643_0000111_103260_103688 129
104 3300046660 Ga0495625_0802918 Ga0495625_0802918_128_520 129
105 3300049823 Ga0501044_1373178 Ga0501044_1373178_62_460 129
106 3300050511 nmdc:mga08y16_389349_c1 nmdc:mga08y16_389349_c1_192_671 129
107 3300053139 Ga0500568_0288254 Ga0500568_0288254_122_556 129
108 3300053153 Ga0500616_0004356 Ga0500616_0004356_9091_9480 129

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wpg-assembly1.cif.gz_A group a streptococcus gaca is an essential dtdp-4-dehydrorhamnose reductase (rmld) 0.6519 3 69
5c53-assembly1.cif.gz_B probing the structural and molecular basis of nucleotide selectivity by human mitochondrial dna polymerase gamma 0.624 6 42
5c52-assembly1.cif.gz_B probing the structural and molecular basis of nucleotide selectivity by human mitochondrial dna polymerase gamma 0.6232 6 42
4rkr-assembly2.cif.gz_C crystal structure of laci family transcriptional regulator from arthrobacter sp. fb24, target efi-560007, complex with lactose 0.5781 4 94
3h5w-assembly1.cif.gz_B crystal structure of the glur2-atd in space group p212121 without solvent 0.5603 4 86
ID Description Score Start End Superfamily
4wpgA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.5803 3 79 3.40.50.720
3trhI00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.5537 7 92 3.40.50.1970
af_A4I570_4_148_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.5532 6 118 3.40.50.10330
5hn5A00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.5487 6 68 3.40.718.10
2lv8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.5475 5 107 3.40.50.11230
ID Description Score Start End GO Terms
AF-A0A6L7UAQ8-F1-model_v4 deleted 0.9896 5 108
AF-A0A2V8DM40-F1-model_v4 Uncharacterized protein 0.9841 5 107
AF-A0A2E1W3X3-F1-model_v4 Uncharacterized protein 0.982 7 109
AF-A0A258AN02-F1-model_v4 Uncharacterized protein 0.98 5 112
AF-A0A3D3NXH6-F1-model_v4 Uncharacterized protein 0.9798 3 108

Feature Viewer

pLDDT pTM Quality
91.79 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map