F044616

General Info

Members Datasets Scaffolds Average Seq Length
107 77 214 122

Family's Representative Sequence

Representative Sequence 3300042136|Ga0450900_025349|Ga0450900_025349_76_504
Length 142
Sequence MAEEQDLTAEEPQPTAEAIKQRRKREKAAAKDAALGVEKFTVEVAGVFKPDLKRVMKAHGINNQQEVYQLLLMNLIAADFDTQAQMLKCVTTPFVVTEKVSRLIAEAGMKSLADDPPEPDDEVEKPETTANPDQVRMVPSPC

Samples

Sample ID Description Type Environment
1 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
8 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
9 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
10 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
11 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
12 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
13 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
14 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
15 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
16 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
17 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
18 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
19 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
21 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
22 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
23 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
24 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
25 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
26 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
27 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
28 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
29 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
30 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
31 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
32 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
33 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
34 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
35 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
36 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
37 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
38 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
39 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
40 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
41 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
42 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
43 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
44 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
45 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
46 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
47 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
48 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
49 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
50 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
51 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
52 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
53 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
54 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
55 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
56 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
57 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
58 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
59 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
60 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
61 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
62 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
63 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
64 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
65 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
66 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
67 2511231015 Pseudomonas sp. GM49 Isolate Nodule
68 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
69 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
70 2784132063 Pseudomonas sp. 424 Isolate Unclassified
71 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
72 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
73 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
74 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
75 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
76 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
77 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.79
Metatranscriptomes 0
Isolates 11.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.48
Nodule 2.8
Rhizoplane 0
Rhizosphere 80.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450900_025349 3300042136 Bacteria 844
2 JGI25162J39368_1000321 3300002737 Bacteria 42159
3 JGI25163J39215_1000098 3300002771 Bacteria 35930
4 JGI25164J39214_1000044 3300002772 Bacteria 125916
5 JGI25165J46597_1000131 3300003214 Bacteria 125895
6 Ga0065704_10125872 3300005289 Bacteria 1697
7 Ga0079104_1000730 3300006946 Bacteria 29122
8 Ga0105251_10003849 3300009011 Bacteria 10695
9 Ga0157373_10423935 3300013100 Bacteria 955
10 Ga0157371_10000334 3300013102 Bacteria 60797
11 Ga0157371_10009429 3300013102 Bacteria 7682
12 Ga0157370_10021844 3300013104 Bacteria 6375
13 Ga0157370_10078974 3300013104 Bacteria 3099
14 Ga0157369_10017455 3300013105 Bacteria 8065
15 Ga0157369_10597999 3300013105 Bacteria 1139
16 Ga0182008_10000493 3300014497 Bacteria 29750
17 Ga0182008_10130747 3300014497 Bacteria 1251
18 Ga0182006_1001178 3300015261 Bacteria 16423
19 Ga0209760_100026 3300025207 Bacteria 153418
20 Ga0207427_100015 3300025231 Bacteria 542133
21 Ga0209437_100027 3300025233 Bacteria 542133
22 Ga0209233_1000039 3300025261 Bacteria 542133
23 Ga0207713_1001492 3300025735 Bacteria 18477
24 Ga0209281_1000015 3300027111 Bacteria 590084
25 Ga0316181_1111392 3300030744 Bacteria 1482
26 Ga0307408_100003510 3300031548 Bacteria 10678
27 Ga0307412_10183404 3300031911 Bacteria 1576
28 Ga0307412_10546824 3300031911 Bacteria 972
29 Ga0439438_146487 3300041405 Bacteria 564
30 Ga0439447_045218 3300041407 Bacteria 1063
31 Ga0439447_081032 3300041407 Bacteria 749
32 Ga0439466_0003968 3300041411 Bacteria 5708
33 Ga0439466_0027923 3300041411 Bacteria 1951
34 Ga0439466_0061102 3300041411 Bacteria 1214
35 Ga0439445_0055205 3300042004 Bacteria 1078
36 Ga0439451_019394 3300042009 Bacteria 1371
37 Ga0439451_020436 3300042009 Bacteria 1335
38 Ga0439456_007162 3300042013 Bacteria 2287
39 Ga0439456_043510 3300042013 Bacteria 976
40 Ga0450902_061409 3300042137 Bacteria 650
41 Ga0495617_001641 3300046452 Bacteria 9627
42 Ga0495617_030110 3300046452 Bacteria 1825
43 Ga0495627_000188 3300046453 Bacteria 68201
44 Ga0495627_000765 3300046453 Bacteria 23893
45 Ga0495590_0000048 3300046457 Bacteria 116368
46 Ga0495638_0004651 3300046460 Bacteria 10381
47 Ga0495584_0000970 3300046491 Bacteria 18000
48 Ga0495584_0057267 3300046491 Bacteria 1961
49 Ga0495585_0002127 3300046492 Bacteria 14476
50 Ga0495596_0000010 3300046500 Bacteria 145028
51 Ga0495596_0000080 3300046500 Bacteria 66323
52 Ga0495606_0000604 3300046507 Bacteria 56852
53 Ga0495606_0001882 3300046507 Bacteria 26291
54 Ga0495606_0007838 3300046507 Bacteria 9429
55 Ga0495610_0004681 3300046512 Bacteria 10005
56 Ga0495616_0000275 3300046513 Bacteria 41769
57 Ga0495616_0027352 3300046513 Bacteria 3027
58 Ga0495620_0000121 3300046515 Bacteria 63161
59 Ga0495632_0002421 3300046519 Bacteria 14210
60 Ga0495637_0000224 3300046520 Bacteria 43789
61 Ga0495648_0003049 3300046524 Bacteria 14990
62 Ga0495648_0007564 3300046524 Bacteria 8683
63 Ga0495654_0000290 3300046530 Bacteria 45364
64 Ga0495654_0002449 3300046530 Bacteria 11943
65 Ga0495654_0003806 3300046530 Bacteria 9127
66 Ga0495654_0212732 3300046530 Bacteria 821
67 Ga0495609_0000205 3300046538 Bacteria 58818
68 Ga0495597_0000954 3300046542 Bacteria 22353
69 Ga0495668_0000238 3300046616 Bacteria 78527
70 Ga0495625_0071926 3300046660 Bacteria 2426
71 Ga0495661_0046844 3300046665 Bacteria 2637
72 Ga0495624_0000142 3300046690 Bacteria 51675
73 Ga0495671_0001352 3300046692 Bacteria 16632
74 Ga0495671_0015014 3300046692 Bacteria 4160
75 Ga0495671_0044051 3300046692 Bacteria 2238
76 Ga0495649_0016270 3300046694 Bacteria 4217
77 Ga0495660_0002253 3300046810 Bacteria 12415
78 Ga0495672_0000268 3300047320 Bacteria 72131
79 Ga0495672_0000416 3300047320 Bacteria 51489
80 Ga0495683_0000065 3300047323 Bacteria 112239
81 Ga0495673_0000276 3300047469 Bacteria 69967
82 Ga0495681_0000087 3300047470 Bacteria 81287
83 Ga0495681_0004166 3300047470 Bacteria 9934
84 Ga0495626_0000238 3300048091 Bacteria 63755
85 Ga0495626_0001067 3300048091 Bacteria 23415
86 Ga0496117_0274855 3300048920 Bacteria 905
87 Ga0496118_0005310 3300048921 Bacteria 14688
88 Ga0496119_0006414 3300048922 Bacteria 10913
89 Ga0496119_0102301 3300048922 Bacteria 1606
90 Ga0496120_0140321 3300048923 Bacteria 1227
91 Ga0496123_0003585 3300048926 Bacteria 17191
92 Ga0496123_0129270 3300048926 Bacteria 1403
93 Ga0495678_003161 3300049459 Bacteria 10392
94 Ga0495682_0042772 3300049460 Bacteria 1660
95 Ga0495682_0107381 3300049460 Bacteria 1000
96 2511318441 2511231015 Bacteria 6598026
97 2624480492 2623620443 Bacteria 6427864
98 2652547182 2651869719 Bacteria 6047974
99 2784264768 2784132063 Bacteria 6262788
100 2809215100 2808606445 Bacteria 6057339
101 2852613198 2852612431 Bacteria 6885235
102 2852669067 2852667396 Bacteria 6885555
103 2919390280 2919385768 Bacteria 5897293
104 2998141984 2998139840 Bacteria 6073514
105 3007869582 3007866637 Bacteria 5899198
106 3007870395 3007866637 Bacteria 5899198
107 8029998684 8029995093 Bacteria 5990776
108 Ga0450900_025349
109 JGI25162J39368_1000321
110 JGI25163J39215_1000098
111 JGI25164J39214_1000044
112 JGI25165J46597_1000131
113 Ga0065704_10125872
114 Ga0079104_1000730
115 Ga0105251_10003849
116 Ga0157373_10423935
117 Ga0157371_10000334
118 Ga0157371_10009429
119 Ga0157370_10021844
120 Ga0157370_10078974
121 Ga0157369_10017455
122 Ga0157369_10597999
123 Ga0182008_10000493
124 Ga0182008_10130747
125 Ga0182006_1001178
126 Ga0209760_100026
127 Ga0207427_100015
128 Ga0209437_100027
129 Ga0209233_1000039
130 Ga0207713_1001492
131 Ga0209281_1000015
132 Ga0316181_1111392
133 Ga0307408_100003510
134 Ga0307412_10183404
135 Ga0307412_10546824
136 Ga0439438_146487
137 Ga0439447_045218
138 Ga0439447_081032
139 Ga0439466_0003968
140 Ga0439466_0027923
141 Ga0439466_0061102
142 Ga0439445_0055205
143 Ga0439451_019394
144 Ga0439451_020436
145 Ga0439456_007162
146 Ga0439456_043510
147 Ga0450902_061409
148 Ga0495617_001641
149 Ga0495617_030110
150 Ga0495627_000188
151 Ga0495627_000765
152 Ga0495590_0000048
153 Ga0495638_0004651
154 Ga0495584_0000970
155 Ga0495584_0057267
156 Ga0495585_0002127
157 Ga0495596_0000010
158 Ga0495596_0000080
159 Ga0495606_0000604
160 Ga0495606_0001882
161 Ga0495606_0007838
162 Ga0495610_0004681
163 Ga0495616_0000275
164 Ga0495616_0027352
165 Ga0495620_0000121
166 Ga0495632_0002421
167 Ga0495637_0000224
168 Ga0495648_0003049
169 Ga0495648_0007564
170 Ga0495654_0000290
171 Ga0495654_0002449
172 Ga0495654_0003806
173 Ga0495654_0212732
174 Ga0495609_0000205
175 Ga0495597_0000954
176 Ga0495668_0000238
177 Ga0495625_0071926
178 Ga0495661_0046844
179 Ga0495624_0000142
180 Ga0495671_0001352
181 Ga0495671_0015014
182 Ga0495671_0044051
183 Ga0495649_0016270
184 Ga0495660_0002253
185 Ga0495672_0000268
186 Ga0495672_0000416
187 Ga0495683_0000065
188 Ga0495673_0000276
189 Ga0495681_0000087
190 Ga0495681_0004166
191 Ga0495626_0000238
192 Ga0495626_0001067
193 Ga0496117_0274855
194 Ga0496118_0005310
195 Ga0496119_0006414
196 Ga0496119_0102301
197 Ga0496120_0140321
198 Ga0496123_0003585
199 Ga0496123_0129270
200 Ga0495678_003161
201 Ga0495682_0042772
202 Ga0495682_0107381
203 2511318441
204 2624480492
205 2652547182
206 2784264768
207 2809215100
208 2852613198
209 2852669067
210 2919390280
211 2998141984
212 3007869582
213 3007870395
214 8029998684

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map