F043348

General Info

Members Datasets Scaffolds Average Seq Length
107 80 214 402

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10004448|Ga0157374_100044484
Length 404
Sequence MLNYRYTARNPQTGQQVKADVQADSEGAAVKLIRAQGLTPIDIRLGEKGANIPGFKFGNRVNAKDRVLFSRQLSTLINAGLPLLQALRSVNEQTTSKPLKVVLNQIITDIEGGGTLSASMAKHPKVFNQVYISLIAAGETSGTLDKALDRLAVQQEKDADLISKVRGALMYPLIVLFVFMVVKVLPQVKNIYSGLKGVQLPLITRVLLAFSDFIIHDWWVVIIVLVALAFFGTRWARTGPGKQVVDKLKMKGWPIGPLFMKMYMARFARTGSTLVASGVPLLQMLQITSDAVNNVHVQRAITKAAEKVRGGKSLADALQNDPNFLPLVPNMLKIGEQSGAMEAMLAKAADYYEKEVDNEVATISSIIEPVMMVLLGVVAFIIVAAVLLPIYGLAGNSQFTSPTG

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
29 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
46 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
51 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
56 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
57 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
58 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
59 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
60 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
61 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
62 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
63 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
64 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
65 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
66 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
67 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
68 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
69 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
70 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
71 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
72 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
73 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
74 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
75 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
76 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
77 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
78 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
79 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
80 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.1
Nodule 0
Rhizoplane 0.93
Rhizosphere 70.09
Stem 0
Stem Tuber 0
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10004448 3300013296 Bacteria 11779
2 JGI24741J21665_1002344 3300001915 Bacteria 4959
3 JGI24740J21852_10018136 3300001979 Bacteria 2505
4 JGI24737J22298_10000003 3300001990 Bacteria 67128
5 JGI24735J21928_10000049 3300002067 Bacteria 51076
6 JGI24742J22300_10000001 3300002244 Bacteria 61784
7 rootL2_10372097 3300003322 Bacteria 1645
8 Ga0070658_10001638 3300005327 Bacteria 18924
9 Ga0070658_10008936 3300005327 Bacteria 8052
10 Ga0070676_10000131 3300005328 Bacteria 28364
11 Ga0070680_100008553 3300005336 Bacteria 7842
12 Ga0070668_100157237 3300005347 Bacteria 1842
13 Ga0070667_100000001 3300005367 Bacteria 1108638
14 Ga0070667_100002250 3300005367 Bacteria 16987
15 Ga0070678_100062342 3300005456 Bacteria 2753
16 Ga0070681_10032068 3300005458 Bacteria 5273
17 Ga0070681_10088407 3300005458 Bacteria 3050
18 Ga0070679_100003722 3300005530 Bacteria 13977
19 Ga0070679_100018290 3300005530 Bacteria 6798
20 Ga0068855_100096945 3300005563 Bacteria 3397
21 Ga0068857_100115521 3300005577 Bacteria 2414
22 Ga0068856_100000002 3300005614 Bacteria 372816
23 Ga0068856_100001703 3300005614 Bacteria 22976
24 Ga0068863_100044324 3300005841 Bacteria 4223
25 Ga0068860_100009902 3300005843 Bacteria 9452
26 Ga0068860_100074432 3300005843 Bacteria 3230
27 Ga0081539_10002512 3300005985 Bacteria 25633
28 Ga0075365_10015481 3300006038 Bacteria 4616
29 Ga0075364_10000111 3300006051 Bacteria 33702
30 Ga0075367_10000366 3300006178 Bacteria 16303
31 Ga0075366_10000010 3300006195 Bacteria 81131
32 Ga0075366_10000095 3300006195 Bacteria 35412
33 Ga0105245_10000001 3300009098 Bacteria 939270
34 Ga0105245_10083912 3300009098 Bacteria 2917
35 Ga0105241_10001013 3300009174 Bacteria 21361
36 Ga0105033_100046 3300009986 Bacteria 9175
37 Ga0105028_100132 3300009993 Bacteria 7793
38 Ga0105246_10018697 3300011119 Bacteria 4418
39 Ga0157378_10418530 3300013297 Bacteria 1324
40 Ga0157372_10000487 3300013307 Bacteria 43763
41 Ga0157377_10015951 3300014745 Bacteria 3854
42 Ga0207705_10000440 3300025909 Bacteria 35983
43 Ga0207705_10050286 3300025909 Bacteria 3000
44 Ga0207654_10008692 3300025911 Bacteria 5147
45 Ga0207707_10113497 3300025912 Bacteria 2368
46 Ga0207660_10002220 3300025917 Bacteria 12856
47 Ga0207660_10006096 3300025917 Bacteria 7825
48 Ga0207660_10030078 3300025917 Bacteria 3731
49 Ga0207652_10004926 3300025921 Bacteria 10803
50 Ga0207652_10067376 3300025921 Bacteria 3104
51 Ga0207652_10084738 3300025921 Bacteria 2777
52 Ga0207687_10000001 3300025927 Bacteria 1130810
53 Ga0207687_10000004 3300025927 Bacteria 841177
54 Ga0207687_10017002 3300025927 Bacteria 4781
55 Ga0207668_10137808 3300025972 Unclassified 1872
56 Ga0207658_10000003 3300025986 Bacteria 1151934
57 Ga0207658_10002914 3300025986 Bacteria 12243
58 Ga0207702_10000001 3300026078 Bacteria 895738
59 Ga0207674_10132254 3300026116 Bacteria 2458
60 Ga0207683_10085790 3300026121 Bacteria 2799
61 Ga0207428_10011625 3300027907 Bacteria 7769
62 Ga0268265_10035689 3300028380 Bacteria 3636
63 Ga0268264_10048104 3300028381 Bacteria 3547
64 Ga0265338_10000462 3300028800 Bacteria 72395
65 Ga0265338_10001220 3300028800 Bacteria 42488
66 Ga0265327_10001269 3300031251 Bacteria 33287
67 Ga0265327_10022896 3300031251 Bacteria 3716
68 Ga0395899_0005103 3300037312 Bacteria 10221
69 Ga0395900_0000612 3300037418 Bacteria 48582
70 Ga0395900_0144469 3300037418 Bacteria 2434
71 Ga0395898_0007332 3300037466 Bacteria 11709
72 Ga0395898_0394245 3300037466 Unclassified 1320
73 Ga0395905_0007140 3300037471 Bacteria 11169
74 Ga0395901_0000815 3300038443 Bacteria 34538
75 Ga0395901_0001516 3300038443 Bacteria 24117
76 Ga0496112_0061487 3300048915 Bacteria 3702
77 Ga0496126_0028219 3300048929 Bacteria 5351
78 Ga0501073_0021363 3300049589 Bacteria 4666
79 Ga0501234_003116 3300049707 Bacteria 2607
80 Ga0501080_0000007 3300049742 Bacteria 135749
81 Ga0501083_0009350 3300049744 Bacteria 6919
82 Ga0501083_0014548 3300049744 Bacteria 5502
83 nmdc:mga00v17_537_c1 3300050491 Bacteria 21238
84 nmdc:mga0yw44_10709_c1 3300050492 Bacteria 4696
85 nmdc:mga0k408_32_c1 3300050493 Bacteria 81544
86 nmdc:mga0k408_40_c1 3300050493 Bacteria 66012
87 nmdc:mga06z11_290_c1 3300050494 Bacteria 19457
88 nmdc:mga08y16_287_c1 3300050511 Bacteria 45722
89 Ga0500643_000009 3300053087 Bacteria 444150
90 Ga0500643_000061 3300053087 Bacteria 127538
91 Ga0500643_000157 3300053087 Bacteria 68258
92 Ga0500644_0001079 3300053088 Bacteria 8056
93 Ga0500644_0018056 3300053088 Bacteria 2059
94 Ga0500646_0000102 3300053090 Bacteria 24333
95 Ga0500583_0011474 3300053092 Bacteria 3341
96 Ga0500650_0000003 3300053098 Bacteria 164144
97 Ga0500562_000002 3300053108 Bacteria 977234
98 Ga0500562_008986 3300053108 Bacteria 2524
99 Ga0500593_000001 3300053117 Bacteria 784404
100 Ga0500594_0000001 3300053118 Bacteria 1178472
101 Ga0500628_000005 3300053129 Bacteria 201423
102 Ga0500655_000190 3300053133 Bacteria 14921
103 Ga0500568_0006784 3300053139 Bacteria 5710
104 Ga0500577_0025071 3300053142 Bacteria 2013
105 Ga0500579_000692 3300053143 Bacteria 19430
106 Ga0500589_019822 3300053147 Bacteria 3063
107 Ga0500622_0031476 3300053156 Bacteria 2784
108 Ga0157374_10004448
109 JGI24741J21665_1002344
110 JGI24740J21852_10018136
111 JGI24737J22298_10000003
112 JGI24735J21928_10000049
113 JGI24742J22300_10000001
114 rootL2_10372097
115 Ga0070658_10001638
116 Ga0070658_10008936
117 Ga0070676_10000131
118 Ga0070680_100008553
119 Ga0070668_100157237
120 Ga0070667_100000001
121 Ga0070667_100002250
122 Ga0070678_100062342
123 Ga0070681_10032068
124 Ga0070681_10088407
125 Ga0070679_100003722
126 Ga0070679_100018290
127 Ga0068855_100096945
128 Ga0068857_100115521
129 Ga0068856_100000002
130 Ga0068856_100001703
131 Ga0068863_100044324
132 Ga0068860_100009902
133 Ga0068860_100074432
134 Ga0081539_10002512
135 Ga0075365_10015481
136 Ga0075364_10000111
137 Ga0075367_10000366
138 Ga0075366_10000010
139 Ga0075366_10000095
140 Ga0105245_10000001
141 Ga0105245_10083912
142 Ga0105241_10001013
143 Ga0105033_100046
144 Ga0105028_100132
145 Ga0105246_10018697
146 Ga0157378_10418530
147 Ga0157372_10000487
148 Ga0157377_10015951
149 Ga0207705_10000440
150 Ga0207705_10050286
151 Ga0207654_10008692
152 Ga0207707_10113497
153 Ga0207660_10002220
154 Ga0207660_10006096
155 Ga0207660_10030078
156 Ga0207652_10004926
157 Ga0207652_10067376
158 Ga0207652_10084738
159 Ga0207687_10000001
160 Ga0207687_10000004
161 Ga0207687_10017002
162 Ga0207668_10137808
163 Ga0207658_10000003
164 Ga0207658_10002914
165 Ga0207702_10000001
166 Ga0207674_10132254
167 Ga0207683_10085790
168 Ga0207428_10011625
169 Ga0268265_10035689
170 Ga0268264_10048104
171 Ga0265338_10000462
172 Ga0265338_10001220
173 Ga0265327_10001269
174 Ga0265327_10022896
175 Ga0395899_0005103
176 Ga0395900_0000612
177 Ga0395900_0144469
178 Ga0395898_0007332
179 Ga0395898_0394245
180 Ga0395905_0007140
181 Ga0395901_0000815
182 Ga0395901_0001516
183 Ga0496112_0061487
184 Ga0496126_0028219
185 Ga0501073_0021363
186 Ga0501234_003116
187 Ga0501080_0000007
188 Ga0501083_0009350
189 Ga0501083_0014548
190 nmdc:mga00v17_537_c1
191 nmdc:mga0yw44_10709_c1
192 nmdc:mga0k408_32_c1
193 nmdc:mga0k408_40_c1
194 nmdc:mga06z11_290_c1
195 nmdc:mga08y16_287_c1
196 Ga0500643_000009
197 Ga0500643_000061
198 Ga0500643_000157
199 Ga0500644_0001079
200 Ga0500644_0018056
201 Ga0500646_0000102
202 Ga0500583_0011474
203 Ga0500650_0000003
204 Ga0500562_000002
205 Ga0500562_008986
206 Ga0500593_000001
207 Ga0500594_0000001
208 Ga0500628_000005
209 Ga0500655_000190
210 Ga0500568_0006784
211 Ga0500577_0025071
212 Ga0500579_000692
213 Ga0500589_019822
214 Ga0500622_0031476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

267

389

0.99

PF00482

T2SSF

Type II secretion system (T2SS), protein F

69

185

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.9721 61 161
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9637 61 168
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9588 60 164
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.9585 61 166
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9489 60 172
ID Description Score Start End Superfamily
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9721 61 161 1.20.81.30
af_P41441_261_365_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9472 268 368 1.20.81.30
af_P36646_52_165_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9415 62 169 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9365 262 365 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9356 61 161 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A0G1Q785-F1-model_v4 Type IV pilin 0.9477 81 402 GO:0005886
AF-A0A2H0FJC4-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9401 229 348 GO:0005886
AF-A0A3D0TQ32-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9376 117 400 GO:0005886
GO:0015628
AF-A0A0G1Q785-F1-model_v4 Type IV pilin 0.9365 81 402 GO:0005886
AF-K2F7Z0-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9311 53 200 GO:0005886

Map