F041889

General Info

Members Datasets Scaffolds Average Seq Length
107 73 107 218

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100095620|Ga0070667_1000956202
Length 231
Sequence MTELSKNNSQNPVRIGVFDSGVGGLSVVNAIKKALPDAEVIYVEDKENVPYGSKSVDELRQLVIPIFRELATRCDVIVVACNTITTTLIKELRATLDVPLVGMEPMVKPAAEQSKTGVIAVCATPATLHSERYNWLKATYAQHTKVLEPDCSDWATMVEKEQVDRDKIKQTVESVIVDGADVIVLGCTHFHWIEDIIRADSDGRATVIQPEEPVIRQLFKVLETIRPAQVS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
60 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
61 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
62 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
63 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
64 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
65 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
66 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
67 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
68 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
69 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
70 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
71 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
72 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
73 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.5
Nodule 0
Rhizoplane 2.8
Rhizosphere 73.83
Stem 0
Stem Tuber 0
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10018920 3300001979 Bacteria 2433
2 JGI24737J22298_10000006 3300001990 Bacteria 62764
3 JGI24735J21928_10000018 3300002067 Bacteria 109218
4 JGI24742J22300_10000007 3300002244 Bacteria 40579
5 rootH1_10353905 3300003323 Unclassified 2812
6 Ga0070658_10000316 3300005327 Bacteria 41532
7 Ga0070658_10000724 3300005327 Bacteria 28557
8 Ga0070670_100011326 3300005331 Bacteria 7622
9 Ga0070660_100000979 3300005339 Bacteria 19111
10 Ga0070691_10016721 3300005341 Unclassified 3372
11 Ga0070671_100000001 3300005355 Bacteria 1228151
12 Ga0070671_100019578 3300005355 Bacteria 5511
13 Ga0070674_100005879 3300005356 Bacteria 7133
14 Ga0070659_100000287 3300005366 Bacteria 39394
15 Ga0070667_100000001 3300005367 Bacteria 1108638
16 Ga0070667_100095620 3300005367 Bacteria 2562
17 Ga0070681_10007077 3300005458 Bacteria 10922
18 Ga0070679_100006318 3300005530 Bacteria 11032
19 Ga0070679_100041675 3300005530 Bacteria 4570
20 Ga0070679_100737370 3300005530 Unclassified 928
21 Ga0068853_100558191 3300005539 Bacteria 1085
22 Ga0070665_100174375 3300005548 Bacteria 2151
23 Ga0070665_100280412 3300005548 Bacteria 1668
24 Ga0068855_100000413 3300005563 Bacteria 52993
25 Ga0068855_101239088 3300005563 Unclassified 774
26 Ga0068857_100000012 3300005577 Bacteria 106243
27 Ga0068856_100000002 3300005614 Bacteria 372816
28 Ga0068856_100398485 3300005614 Bacteria 1396
29 Ga0068863_100108899 3300005841 Bacteria 2637
30 Ga0068860_100203679 3300005843 Bacteria 1918
31 Ga0081455_10000008 3300005937 Bacteria 256558
32 Ga0075365_10000013 3300006038 Bacteria 80137
33 Ga0075365_10002312 3300006038 Bacteria 9275
34 Ga0075365_10020515 3300006038 Bacteria 4099
35 Ga0075365_10023097 3300006038 Bacteria 3907
36 Ga0075364_10263812 3300006051 Unclassified 1171
37 Ga0075364_10279704 3300006051 Unclassified 1135
38 Ga0075366_10001100 3300006195 Bacteria 13279
39 Ga0075366_10002684 3300006195 Bacteria 9179
40 Ga0068871_100453036 3300006358 Unclassified 1150
41 Ga0105245_10000001 3300009098 Bacteria 939270
42 Ga0105245_10318929 3300009098 Bacteria 1530
43 Ga0105245_10542064 3300009098 Bacteria 1185
44 Ga0105241_10548935 3300009174 Unclassified 1037
45 Ga0105248_10044353 3300009177 Bacteria 4987
46 Ga0105239_10129083 3300010375 Bacteria 2810
47 Ga0105246_10242363 3300011119 Bacteria 1426
48 Ga0157371_10001430 3300013102 Bacteria 24798
49 Ga0157370_10728771 3300013104 Bacteria 904
50 Ga0157374_10151976 3300013296 Bacteria 2251
51 Ga0163163_10001419 3300014325 Bacteria 20271
52 Ga0207705_10000351 3300025909 Bacteria 41581
53 Ga0207705_10031761 3300025909 Unclassified 3771
54 Ga0207707_10006341 3300025912 Bacteria 10330
55 Ga0207657_10000997 3300025919 Bacteria 30085
56 Ga0207652_10010817 3300025921 Bacteria 7351
57 Ga0207652_10037641 3300025921 Bacteria 4095
58 Ga0207652_10536754 3300025921 Bacteria 1052
59 Ga0207650_10095763 3300025925 Bacteria 2276
60 Ga0207687_10000001 3300025927 Bacteria 1130810
61 Ga0207687_10000004 3300025927 Bacteria 841177
62 Ga0207687_10222987 3300025927 Bacteria 1485
63 Ga0207687_10479000 3300025927 Bacteria 1036
64 Ga0207644_10000001 3300025931 Bacteria 1243214
65 Ga0207644_10332533 3300025931 Bacteria 1230
66 Ga0207690_10000870 3300025932 Bacteria 19292
67 Ga0207711_10430389 3300025941 Bacteria 1228
68 Ga0207667_10000060 3300025949 Bacteria 192320
69 Ga0207667_10001786 3300025949 Bacteria 27062
70 Ga0207658_10000003 3300025986 Bacteria 1151934
71 Ga0207703_10132151 3300026035 Bacteria 2157
72 Ga0207702_10000001 3300026078 Bacteria 895738
73 Ga0207702_10468812 3300026078 Bacteria 1224
74 Ga0207674_10000015 3300026116 Bacteria 183445
75 Ga0268266_10001890 3300028379 Bacteria 23634
76 Ga0268264_10043386 3300028381 Bacteria 3727
77 Ga0265338_10057585 3300028800 Unclassified 3437
78 Ga0265338_10101338 3300028800 Bacteria 2345
79 Ga0265338_10176595 3300028800 Unclassified 1632
80 Ga0265327_10002241 3300031251 Bacteria 20944
81 Ga0265327_10007364 3300031251 Bacteria 8517
82 Ga0265327_10106597 3300031251 Unclassified 1345
83 Ga0395900_0071653 3300037418 Bacteria 3563
84 Ga0395901_0001913 3300038443 Bacteria 21439
85 Ga0451807_1159705 3300041486 Bacteria 1250
86 Ga0466967_0636922 3300045976 Bacteria 1054
87 Ga0495588_0000287 3300046674 Bacteria 37043
88 Ga0496112_0032207 3300048915 Bacteria 5089
89 Ga0496113_0231391 3300048916 Bacteria 1474
90 Ga0496125_0119251 3300048928 Bacteria 1887
91 Ga0501073_0087212 3300049589 Unclassified 2171
92 Ga0501080_0000178 3300049742 Bacteria 46844
93 nmdc:mga00v17_247885_c1 3300050491 Unclassified 1155
94 nmdc:mga00v17_9349_c1 3300050491 Bacteria 5298
95 nmdc:mga0yw44_12854_c1 3300050492 Bacteria 4381
96 nmdc:mga0yw44_25411_c1 3300050492 Bacteria 3367
97 nmdc:mga0yw44_8_c1 3300050492 Bacteria 237802
98 nmdc:mga0yw44_93_c1 3300050492 Bacteria 31138
99 nmdc:mga0k408_10_c1 3300050493 Bacteria 64050
100 nmdc:mga0k408_29_c1 3300050493 Bacteria 89645
101 Ga0500643_002040 3300053087 Bacteria 10824
102 Ga0500643_035644 3300053087 Unclassified 1490
103 Ga0500651_0000019 3300053093 Bacteria 141974
104 Ga0500594_0000024 3300053118 Bacteria 52779
105 Ga0500561_0000002 3300053137 Bacteria 394147
106 Ga0500604_0018299 3300053151 Bacteria 1951
107 Ga0500616_0188770 3300053153 Bacteria 922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005530 Ga0070679_100737370 Ga0070679_1007373702 199
2 3300025921 Ga0207652_10536754 Ga0207652_105367542 201
3 3300031251 Ga0265327_10002241 Ga0265327_1000224120 201
4 3300011119 Ga0105246_10242363 Ga0105246_102423631 207
5 3300031251 Ga0265327_10106597 Ga0265327_101065972 210
6 3300006195 Ga0075366_10001100 Ga0075366_1000110019 211
7 3300050493 nmdc:mga0k408_10_c1 nmdc:mga0k408_10_c1_61540_62178 211
8 3300005331 Ga0070670_100011326 Ga0070670_1000113263 212
9 3300005355 Ga0070671_100000001 Ga0070671_100000001871 212
10 3300005367 Ga0070667_100000001 Ga0070667_100000001418 212
11 3300005367 Ga0070667_100095620 Ga0070667_1000956202 212
12 3300005548 Ga0070665_100174375 Ga0070665_1001743753 212
13 3300005843 Ga0068860_100203679 Ga0068860_1002036793 212
14 3300006358 Ga0068871_100453036 Ga0068871_1004530362 212
15 3300009177 Ga0105248_10044353 Ga0105248_100443534 212
16 3300025925 Ga0207650_10095763 Ga0207650_100957633 212
17 3300025931 Ga0207644_10000001 Ga0207644_10000001563 212
18 3300025941 Ga0207711_10430389 Ga0207711_104303891 212
19 3300025986 Ga0207658_10000003 Ga0207658_10000003958 212
20 3300026035 Ga0207703_10132151 Ga0207703_101321512 212
21 3300028381 Ga0268264_10043386 Ga0268264_100433862 212
22 3300031251 Ga0265327_10007364 Ga0265327_100073642 212
23 3300045976 Ga0466967_0636922 Ga0466967_0636922_74_733 212
24 3300049742 Ga0501080_0000178 Ga0501080_0000178_6816_7463 212
25 3300053087 Ga0500643_002040 Ga0500643_002040_6565_7206 212
26 3300053093 Ga0500651_0000019 Ga0500651_0000019_116893_117534 212
27 3300053118 Ga0500594_0000024 Ga0500594_0000024_13522_14163 212
28 3300001990 JGI24737J22298_10000006 JGI24737J22298_1000000651 213
29 3300002067 JGI24735J21928_10000018 JGI24735J21928_10000018109 213
30 3300002244 JGI24742J22300_10000007 JGI24742J22300_1000000729 213
31 3300003323 rootH1_10353905 rootH1_103539053 213
32 3300005327 Ga0070658_10000316 Ga0070658_1000031633 213
33 3300005327 Ga0070658_10000724 Ga0070658_100007241 213
34 3300005339 Ga0070660_100000979 Ga0070660_1000009799 213
35 3300005341 Ga0070691_10016721 Ga0070691_100167215 213
36 3300005355 Ga0070671_100019578 Ga0070671_1000195787 213
37 3300005356 Ga0070674_100005879 Ga0070674_1000058798 213
38 3300005366 Ga0070659_100000287 Ga0070659_10000028732 213
39 3300005458 Ga0070681_10007077 Ga0070681_100070774 213
40 3300005530 Ga0070679_100006318 Ga0070679_1000063187 213
41 3300005530 Ga0070679_100041675 Ga0070679_1000416752 213
42 3300005548 Ga0070665_100280412 Ga0070665_1002804122 213
43 3300005563 Ga0068855_100000413 Ga0068855_10000041349 213
44 3300005563 Ga0068855_101239088 Ga0068855_1012390881 213
45 3300005577 Ga0068857_100000012 Ga0068857_10000001236 213
46 3300005614 Ga0068856_100000002 Ga0068856_10000000212 213
47 3300005614 Ga0068856_100398485 Ga0068856_1003984852 213
48 3300005841 Ga0068863_100108899 Ga0068863_1001088992 213
49 3300005937 Ga0081455_10000008 Ga0081455_10000008131 213
50 3300006038 Ga0075365_10000013 Ga0075365_1000001359 213
51 3300006038 Ga0075365_10020515 Ga0075365_100205154 213
52 3300006038 Ga0075365_10023097 Ga0075365_100230972 213
53 3300006051 Ga0075364_10263812 Ga0075364_102638122 213
54 3300006051 Ga0075364_10279704 Ga0075364_102797042 213
55 3300006195 Ga0075366_10002684 Ga0075366_100026848 213
56 3300009098 Ga0105245_10000001 Ga0105245_10000001632 213
57 3300009098 Ga0105245_10318929 Ga0105245_103189292 213
58 3300009098 Ga0105245_10542064 Ga0105245_105420642 213
59 3300009174 Ga0105241_10548935 Ga0105241_105489352 213
60 3300010375 Ga0105239_10129083 Ga0105239_101290832 213
61 3300013102 Ga0157371_10001430 Ga0157371_1000143016 213
62 3300013104 Ga0157370_10728771 Ga0157370_107287712 213
63 3300014325 Ga0163163_10001419 Ga0163163_1000141921 213
64 3300025909 Ga0207705_10000351 Ga0207705_1000035133 213
65 3300025909 Ga0207705_10031761 Ga0207705_100317615 213
66 3300025912 Ga0207707_10006341 Ga0207707_100063413 213
67 3300025919 Ga0207657_10000997 Ga0207657_100009979 213
68 3300025921 Ga0207652_10010817 Ga0207652_100108172 213
69 3300025921 Ga0207652_10037641 Ga0207652_100376412 213
70 3300025927 Ga0207687_10000001 Ga0207687_10000001193 213
71 3300025927 Ga0207687_10000004 Ga0207687_10000004640 213
72 3300025927 Ga0207687_10222987 Ga0207687_102229872 213
73 3300025927 Ga0207687_10479000 Ga0207687_104790002 213
74 3300025931 Ga0207644_10332533 Ga0207644_103325332 213
75 3300025932 Ga0207690_10000870 Ga0207690_100008709 213
76 3300025949 Ga0207667_10000060 Ga0207667_100000609 213
77 3300025949 Ga0207667_10001786 Ga0207667_1000178638 213
78 3300026078 Ga0207702_10000001 Ga0207702_10000001416 213
79 3300026078 Ga0207702_10468812 Ga0207702_104688122 213
80 3300026116 Ga0207674_10000015 Ga0207674_1000001559 213
81 3300028379 Ga0268266_10001890 Ga0268266_1000189019 213
82 3300028800 Ga0265338_10057585 Ga0265338_100575854 213
83 3300028800 Ga0265338_10101338 Ga0265338_101013384 213
84 3300028800 Ga0265338_10176595 Ga0265338_101765952 213
85 3300037418 Ga0395900_0071653 Ga0395900_0071653_1893_2540 213
86 3300038443 Ga0395901_0001913 Ga0395901_0001913_14584_15231 213
87 3300041486 Ga0451807_1159705 Ga0451807_1159705_296_952 213
88 3300046674 Ga0495588_0000287 Ga0495588_0000287_11819_12466 213
89 3300048915 Ga0496112_0032207 Ga0496112_0032207_3302_3949 213
90 3300048916 Ga0496113_0231391 Ga0496113_0231391_92_739 213
91 3300048928 Ga0496125_0119251 Ga0496125_0119251_1067_1723 213
92 3300049589 Ga0501073_0087212 Ga0501073_0087212_955_1602 213
93 3300050491 nmdc:mga00v17_247885_c1 nmdc:mga00v17_247885_c1_141_812 213
94 3300050491 nmdc:mga00v17_9349_c1 nmdc:mga00v17_9349_c1_322_1005 213
95 3300050492 nmdc:mga0yw44_12854_c1 nmdc:mga0yw44_12854_c1_3149_3811 213
96 3300050492 nmdc:mga0yw44_25411_c1 nmdc:mga0yw44_25411_c1_1948_2619 213
97 3300050492 nmdc:mga0yw44_8_c1 nmdc:mga0yw44_8_c1_121360_122013 213
98 3300050493 nmdc:mga0k408_29_c1 nmdc:mga0k408_29_c1_85074_85745 213
99 3300053087 Ga0500643_035644 Ga0500643_035644_18_668 213
100 3300053137 Ga0500561_0000002 Ga0500561_0000002_11512_12156 213
101 3300053151 Ga0500604_0018299 Ga0500604_0018299_598_1245 213
102 3300053153 Ga0500616_0188770 Ga0500616_0188770_209_859 213
103 3300001979 JGI24740J21852_10018920 JGI24740J21852_100189203 214
104 3300005539 Ga0068853_100558191 Ga0068853_1005581911 214
105 3300006038 Ga0075365_10002312 Ga0075365_100023129 214
106 3300013296 Ga0157374_10151976 Ga0157374_101519762 214
107 3300050492 nmdc:mga0yw44_93_c1 nmdc:mga0yw44_93_c1_21148_21792 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01177

Asp_Glu_race

Asp/Glu/Hydantoin racemase

15

217

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ist-assembly1.cif.gz_A crystal structure of glutamate racemase from listeria monocytogenes in complex with succinic acid 0.9184 1 209
3ist-assembly1.cif.gz_A crystal structure of glutamate racemase from listeria monocytogenes in complex with succinic acid 0.9102 1 209
2jfn-assembly1.cif.gz_A crystal structure of escherichia coli glutamate racemase in complex with l- glutamate and activator udp-murnac-ala 0.9081 2 209
2jfo-assembly1.cif.gz_B crystal structure of enterococcus faecalis glutamate racemase in complex with d- and l-glutamate 0.9035 2 209
2vvt-assembly1.cif.gz_A glutamate racemase (muri) from e. faecalis in complex with a 9-benzyl purine inhibitor 0.9015 2 209
ID Description Score Start End Superfamily
af_P22634_23_240_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9204 3 208 3.30.479.30
af_P22634_23_240_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.8998 3 208 3.30.479.30
af_P9WPW9_6_95_3.40.50.1860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8904 1 87 3.40.50.1860
af_Q2FZC6_1_266_3.40.50.1860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8724 2 209 3.40.50.1860
af_Q2FZC6_4_227_3.40.50.12500 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8715 3 209 3.40.50.12500
ID Description Score Start End GO Terms
AF-A0A1J5I063-F1-model_v4 Uncharacterized protein 0.9895 1 210 GO:0008881
AF-A0A1J5I063-F1-model_v4 Uncharacterized protein 0.9849 1 210 GO:0008881
AF-A0A1F7R7D1-F1-model_v4 Glutamate racemase (EC 5.1.1.3) 0.9692 1 209 GO:0008360
GO:0008881
GO:0009252
GO:0071555
AF-A0A4Q0AJD2-F1-model_v4 Uncharacterized protein 0.9665 1 209 GO:0008881
GO:0009252
AF-A0A6N6M229-F1-model_v4 Glutamate racemase (EC 5.1.1.3) 0.966 2 209 GO:0008360
GO:0008881
GO:0009252
GO:0071555

Feature Viewer

pLDDT pTM Quality
95.46 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map