F035031

General Info

Members Datasets Scaffolds Average Seq Length
105 83 64 526

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2816332305|2817510008
Length 617
Sequence NRTTRHPTRPENAHRGSPDGGAPRTVVVGGGFAGLATAGLLARDGHRVTLLEQRDTLGGRSGRWSAEGFTFDTGPSWYLMPEVIDRWFTLMGSSADEQLDLRRLDPGYRTFFEQHLDEPPTDVRAGHAEELFERLDPGSSEALRAYLGSGAEVYDLAKKHFLYTNFSRPTDLARAEVLRNLPRLGGLLSTSMQRYVAARFRDPRQRQILGYPAVFLGASPDTAPAMYHLMSHLDLTDGVQYPVGGFAALVDAMERLVRAAGVEIVTGAEVTGIEVAPAPASLRSRVGAARARRRSAGSVTGVTWRAAAPEEGVRAGQDGAAGAPGARGAVRDADGPGGVVEGPGVVAEGRGTRTDASAEARGAGTDAPAGQPGDGEERTVTADVVIGAADLHHLQTRLLPDDFRAPESRWTHRDPGPSGVLVCLGVRGKLPQLVHHNLLFTADWDDNFGRIADGTPLAEQTSIYVSMTSATDPGTAPEGDENLFILVPSPAVPEWGRGGVRTPDTDEPGSPQVERVADAAIAQLARWAEIPDLAERIVVRRTYGPGDFEAQFNAWRGSMLGPGHTLRQSALFRPGVTDPGIEGLYYAGSSVRPGIGVPMCLISSEVVRDAVRERGGR

Samples

Sample ID Description Type Environment
1 2643221575 Microbacterium sp. Root61 Isolate Unclassified
2 2643221597 Microbacterium sp. Root180 Isolate Unclassified
3 2643221649 Leifsonia sp. Root4 Isolate Unclassified
4 2739367653 Kocuria sp. OV113 Isolate Unclassified
5 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
6 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
7 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
8 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
9 2773857759 Microbacterium sp. 1294 Isolate Unclassified
10 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
11 2808606394 Promicromonospora sp. C35 Isolate Unclassified
12 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
13 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
14 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
15 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
16 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
17 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
18 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
19 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
20 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
21 2857727296 Kocuria sp. R-72562 Isolate Unclassified
22 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
23 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
24 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
25 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
26 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
27 2919069694 Microbacterium sp. 1154 Isolate Unclassified
28 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
29 2928153084 Leifsonia sp. 563 Isolate Unclassified
30 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
31 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
32 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
33 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
34 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
35 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
36 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
37 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
40 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
54 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
55 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
56 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
57 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
58 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
59 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
60 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
61 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
62 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
63 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
72 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
73 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
76 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
77 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
78 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
79 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
80 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
81 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
82 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
83 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 58.1
Metatranscriptomes 2.86
Isolates 39.05

Biome Distribution

Category Percentage (%)
Aerial Root 1.9
Bulb 0
Endosphere 10.48
Nodule 0
Rhizoplane 0
Rhizosphere 42.86
Stem 0
Stem Tuber 0
Unclassified 44.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10004031 3300002067 Bacteria 4958
2 JGI25165J46597_1000004 3300003214 Bacteria 667510
3 Ga0006562J51391_1017886 3300003578 Bacteria 5349
4 Ga0006562J51391_1017887 3300003578 Bacteria 5150
5 Ga0006562J51391_1035461 3300003578 Bacteria 5390
6 Ga0070696_100003235 3300005546 Bacteria 10849
7 Ga0105244_10032156 3300009036 Bacteria 2780
8 Ga0105245_10002553 3300009098 Bacteria 16399
9 Ga0157369_10001098 3300013105 Bacteria 33862
10 Ga0157369_10040069 3300013105 Bacteria 5116
11 Ga0209563_100278 3300025230 Bacteria 21585
12 Ga0207427_100010 3300025231 Bacteria 648610
13 Ga0209437_100216 3300025233 Bacteria 106353
14 Ga0209233_1000001 3300025261 Bacteria 2992747
15 Ga0207698_10000112 3300026142 Bacteria 50642
16 Ga0307406_10000018 3300031901 Bacteria 101770
17 Ga0395899_0007471 3300037312 Bacteria 8442
18 Ga0395899_0072610 3300037312 Bacteria 2518
19 Ga0395898_0000015 3300037466 Bacteria 439819
20 Ga0466965_0000494 3300044683 Bacteria 14000
21 Ga0466970_0000660 3300044765 Bacteria 16945
22 Ga0496117_0000174 3300048920 Bacteria 132648
23 Ga0496117_0000585 3300048920 Bacteria 60104
24 Ga0496117_0013843 3300048920 Bacteria 6997
25 Ga0496119_0002840 3300048922 Bacteria 18497
26 Ga0496119_0007908 3300048922 Bacteria 9464
27 Ga0496119_0026040 3300048922 Bacteria 4067
28 Ga0496120_0001325 3300048923 Bacteria 30524
29 Ga0496120_0008105 3300048923 Bacteria 7717
30 Ga0496121_0000046 3300048924 Bacteria 335942
31 Ga0496121_0035143 3300048924 Bacteria 4496
32 Ga0496122_0001030 3300048925 Bacteria 49002
33 Ga0496122_0017985 3300048925 Bacteria 6558
34 Ga0496123_0007193 3300048926 Bacteria 10563
35 Ga0496123_0031646 3300048926 Bacteria 3846
36 Ga0496123_0040531 3300048926 Bacteria 3242
37 Ga0496125_0000066 3300048928 Bacteria 249043
38 Ga0496125_0000077 3300048928 Bacteria 232629
39 Ga0496125_0014859 3300048928 Bacteria 7560
40 Ga0496126_0018778 3300048929 Bacteria 6837
41 Ga0501031_0009375 3300049568 Bacteria 6364
42 Ga0501032_0011492 3300049569 Bacteria 6359
43 Ga0501033_0157399 3300049570 Bacteria 1636
44 Ga0501034_0010449 3300049571 Bacteria 9669
45 Ga0501034_0037312 3300049571 Bacteria 4920
46 Ga0501034_0051883 3300049571 Bacteria 4134
47 Ga0501038_0006823 3300049574 Bacteria 10544
48 Ga0501043_0009891 3300049579 Bacteria 7476
49 Ga0501046_0007791 3300049580 Bacteria 9396
50 Ga0501047_0052871 3300049581 Bacteria 3926
51 Ga0501068_0016809 3300049584 Bacteria 4223
52 Ga0501068_0062252 3300049584 Bacteria 2269
53 Ga0501070_0000399 3300049586 Bacteria 39685
54 Ga0501035_0100588 3300049822 Bacteria 2538
55 Ga0501044_0013647 3300049823 Bacteria 8780
56 Ga0501044_0065488 3300049823 Bacteria 3706
57 Ga0501044_0191331 3300049823 Bacteria 2008
58 Ga0501045_0005001 3300049824 Bacteria 9189
59 Ga0500635_0000028 3300053080 Bacteria 104398
60 Ga0500559_0000202 3300053136 Bacteria 47695
61 Ga0500573_0004170 3300053140 Bacteria 7575
62 Ga0500573_0027310 3300053140 Bacteria 3282
63 Ga0500573_0071859 3300053140 Bacteria 1973
64 Ga0500645_005694 3300053730 Bacteria 4546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009036 Ga0105244_10032156 Ga0105244_100321562 473
2 3300037312 Ga0395899_0007471 Ga0395899_0007471_5430_7100 480
3 3300013105 Ga0157369_10040069 Ga0157369_100400692 481
4 3300048925 Ga0496122_0017985 Ga0496122_0017985_1618_3174 481
5 3300048926 Ga0496123_0040531 Ga0496123_0040531_715_2271 481
6 3300048928 Ga0496125_0014859 Ga0496125_0014859_4668_6224 481
7 3300049581 Ga0501047_0052871 Ga0501047_0052871_1825_3375 481
8 3300049823 Ga0501044_0013647 Ga0501044_0013647_1768_3318 481
9 3300003578 Ga0006562J51391_1035461 Ga0006562J51391_10354613 483
10 3300048928 Ga0496125_0000077 Ga0496125_0000077_171435_172976 486
11 3300048920 Ga0496117_0000585 Ga0496117_0000585_53950_55506 489
12 3300048923 Ga0496120_0008105 Ga0496120_0008105_1579_3135 489
13 3300048929 Ga0496126_0018778 Ga0496126_0018778_4581_6137 489
14 3300049570 Ga0501033_0157399 Ga0501033_0157399_68_1615 494
15 3300003578 Ga0006562J51391_1017886 Ga0006562J51391_10178863 497
16 3300003578 Ga0006562J51391_1017887 Ga0006562J51391_10178874 497
17 3300026142 Ga0207698_10000112 Ga0207698_1000011242 497
18 3300053080 Ga0500635_0000028 Ga0500635_0000028_89113_90717 499
19 iso_pu_bacteria 2773857759 2774384163 499
20 iso_pu_bacteria 2977251589 2977254322 499
21 iso_pu_bacteria 2643221575 2643885881 500
22 iso_pu_bacteria 2757320536 2758226457 501
23 iso_pu_bacteria 2773857758 2774380054 501
24 iso_pu_bacteria 2904509784 2904511668 501
25 iso_pu_bacteria 2908678064 2908680594 501
26 iso_pu_bacteria 2919069694 2919071849 501
27 iso_pu_bacteria 2974294766 2974297509 501
28 iso_pu_bacteria 2974324384 2974326254 501
29 iso_pu_bacteria 2977228692 2977231741 501
30 iso_pu_bacteria 2977264416 2977267055 501
31 iso_pu_bacteria 2984542743 2984545112 501
32 iso_pu_bacteria 8016254467 8016257228 501
33 3300005546 Ga0070696_100003235 Ga0070696_1000032359 502
34 3300009098 Ga0105245_10002553 Ga0105245_100025536 502
35 3300048924 Ga0496121_0000046 Ga0496121_0000046_135315_136847 502
36 3300048924 Ga0496121_0035143 Ga0496121_0035143_2910_4460 502
37 3300049824 Ga0501045_0005001 Ga0501045_0005001_7077_8681 502
38 3300049822 Ga0501035_0100588 Ga0501035_0100588_265_1872 503
39 iso_pu_bacteria 2739367653 2739604374 503
40 iso_pu_bacteria 2857727296 2857729307 503
41 iso_pu_bacteria 2946041624 2946042023 503
42 3300048922 Ga0496119_0007908 Ga0496119_0007908_3153_4718 504
43 iso_pu_bacteria 2808606447 2809227725 504
44 iso_pu_bacteria 2852632344 2852634480 504
45 3300031901 Ga0307406_10000018 Ga0307406_1000001863 505
46 3300044683 Ga0466965_0000494 Ga0466965_0000494_5241_6809 505
47 3300044765 Ga0466970_0000660 Ga0466970_0000660_7539_9095 505
48 3300048922 Ga0496119_0002840 Ga0496119_0002840_12522_14078 505
49 3300048923 Ga0496120_0001325 Ga0496120_0001325_11915_13471 505
50 iso_pu_bacteria 2643221597 2643997654 505
51 iso_pu_bacteria 2773857763 2774399075 505
52 iso_pu_bacteria 2870628048 2870630684 505
53 iso_pu_bacteria 2758568621 2760624609 506
54 iso_pu_bacteria 2808606394 2809029522 506
55 iso_pu_bacteria 2857720070 2857721189 506
56 iso_pu_bacteria 2928090899 2928092163 506
57 iso_pu_bacteria 2984580707 2984581064 506
58 iso_pu_bacteria 8056579771 8056583559 506
59 3300053140 Ga0500573_0004170 Ga0500573_0004170_4275_5834 507
60 3300053730 Ga0500645_005694 Ga0500645_005694_2584_4350 507
61 iso_pu_bacteria 2739367654 2739606298 507
62 iso_pu_bacteria 2893684298 2893685742 507
63 3300048926 Ga0496123_0007193 Ga0496123_0007193_3837_5447 508
64 iso_pu_bacteria 2811994872 2812323647 508
65 iso_pu_bacteria 2811994880 2812364047 508
66 iso_pu_bacteria 2852643534 2852644085 508
67 3300049568 Ga0501031_0009375 Ga0501031_0009375_4311_5915 509
68 3300049569 Ga0501032_0011492 Ga0501032_0011492_2008_3573 509
69 3300049571 Ga0501034_0037312 Ga0501034_0037312_1621_3225 509
70 3300049571 Ga0501034_0051883 Ga0501034_0051883_1243_2808 509
71 3300049574 Ga0501038_0006823 Ga0501038_0006823_8387_9991 509
72 3300049579 Ga0501043_0009891 Ga0501043_0009891_5714_7318 509
73 3300049580 Ga0501046_0007791 Ga0501046_0007791_5822_7426 509
74 3300049584 Ga0501068_0016809 Ga0501068_0016809_601_2205 509
75 3300049584 Ga0501068_0062252 Ga0501068_0062252_579_2144 509
76 3300049823 Ga0501044_0065488 Ga0501044_0065488_931_2496 509
77 3300049823 Ga0501044_0191331 Ga0501044_0191331_180_1784 509
78 3300049571 Ga0501034_0010449 Ga0501034_0010449_6300_7859 510
79 iso_pu_bacteria 2816332305 2817510008 510
80 iso_pu_bacteria 2844852863 2844853569 510
81 iso_pu_bacteria 2857632687 2857634466 510
82 iso_pu_bacteria 2870804320 2870805915 510
83 iso_pu_bacteria 8056037122 8056040368 510
84 3300048922 Ga0496119_0026040 Ga0496119_0026040_494_2179 511
85 3300048925 Ga0496122_0001030 Ga0496122_0001030_7713_9398 511
86 3300048928 Ga0496125_0000066 Ga0496125_0000066_73817_75502 511
87 3300013105 Ga0157369_10001098 Ga0157369_1000109821 512
88 3300037312 Ga0395899_0072610 Ga0395899_0072610_835_2445 512
89 3300037466 Ga0395898_0000015 Ga0395898_0000015_167680_169290 512
90 3300053140 Ga0500573_0027310 Ga0500573_0027310_1316_2926 512
91 3300053140 Ga0500573_0071859 Ga0500573_0071859_66_1685 512
92 iso_pu_bacteria 2643221649 2644280089 512
93 3300048920 Ga0496117_0000174 Ga0496117_0000174_100855_102669 513
94 3300053136 Ga0500559_0000202 Ga0500559_0000202_10334_11938 513
95 iso_pu_bacteria 8057345674 8057346543 514
96 3300025230 Ga0209563_100278 Ga0209563_1002788 517
97 iso_pu_bacteria 2928153084 2928156213 517
98 3300003214 JGI25165J46597_1000004 JGI25165J46597_1000004377 518
99 3300025231 Ga0207427_100010 Ga0207427_100010204 518
100 3300025233 Ga0209437_100216 Ga0209437_1002162 518
101 3300025261 Ga0209233_1000001 Ga0209233_10000011745 518
102 3300049586 Ga0501070_0000399 Ga0501070_0000399_21704_23311 518
103 3300002067 JGI24735J21928_10004031 JGI24735J21928_100040313 521
104 3300048920 Ga0496117_0013843 Ga0496117_0013843_5128_6726 521
105 3300048926 Ga0496123_0031646 Ga0496123_0031646_1718_3580 521

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

24

63

0.94

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

27

93

0.91

PF00890

FAD_binding_2

FAD binding domain

24

100

0.87

PF01593

Amino_oxidase

Flavin containing amine oxidoreductase

32

294

0.7

PF01266

DAO

FAD dependent oxidoreductase

24

302

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j0e-assembly1.cif.gz_B crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p1 space group 0.9867 4 35
4j0e-assembly1.cif.gz_A crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p1 space group 0.9843 4 35
4j0f-assembly1.cif.gz_A crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p212121 space group 0.9783 4 36
4j0f-assembly1.cif.gz_B crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p212121 space group 0.9676 4 36
2y0d-assembly1.cif.gz_D bcec mutation y10k 0.9655 4 34
ID Description Score Start End Superfamily
af_I6Y4U4_173_293_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9997 4 38 3.50.50.60
af_P9WHH5_150_268_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9892 4 38 3.50.50.60
4ywoA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9873 4 38 3.50.50.60
af_P9WFZ3_1_135_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9856 4 36 3.40.50.720
3lxdA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9818 4 38 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A841ART9-F1-model_v4 Phytoene desaturase 0.9798 4 515 GO:0016117
GO:0016491
AF-A0A221RBK8-F1-model_v4 Amine oxidase domain-containing protein 0.9787 1 514 GO:0016117
GO:0016491
AF-A0A0M2CXU4-F1-model_v4 Phytoene dehydrogenase 0.9784 3 515 GO:0004311
GO:0016117
GO:0016491
GO:0051996
AF-A0A7X9GU63-F1-model_v4 Phytoene desaturase 0.9755 1 353 GO:0016117
GO:0016491
AF-A0A3N2HGK0-F1-model_v4 Phytoene desaturase 0.975 3 515 GO:0016117
GO:0016491

Feature Viewer

pLDDT pTM Quality
89.32 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map