F029816

General Info

Members Datasets Scaffolds Average Seq Length
105 84 89 223

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10023516|Ga0055531_100235163
Length 248
Sequence MDPSLRWDDDRKDSQVSGYANFGKHRIPMLKLFYGGTFDPVHNGHLAIARAARDELDCSVRLMPAADPPHRAPPGADAGQRAEMLDLAVADQPGLRVDRRELRRQGRSYTIDTLRQLRVEFGPDTPIALLIGADSFVGLPTWREWQALFDFAHFLVAPRPGSPLDGELSAELTAAAAGRWTESPQALKTTPAGRLFLLNEPLHPESASDIRRRIACGEPWQGLVSPAVAEFIVRNDLYSQPAPEPSPL

Samples

Sample ID Description Type Environment
1 2643221559 Lysobacter sp. Root559 Isolate Unclassified
2 2643221573 Lysobacter sp. Root604 Isolate Unclassified
3 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
4 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221593 Lysobacter sp. Root690 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221720 Lysobacter sp. Root916 Isolate Unclassified
9 2643221727 Lysobacter sp. Root96 Isolate Unclassified
10 2643221728 Lysobacter sp. Root983 Isolate Unclassified
11 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
12 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
13 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
14 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
15 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
58 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
59 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
60 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
61 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
62 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
63 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
64 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
65 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
66 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
67 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
68 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
69 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
70 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
71 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
74 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
75 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
76 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
77 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
78 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
79 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
80 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
83 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
84 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.76
Metatranscriptomes 0
Isolates 15.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.95
Bulb 0
Endosphere 19.05
Nodule 0
Rhizoplane 4.76
Rhizosphere 53.33
Stem 0
Stem Tuber 0
Unclassified 21.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000070 3300003187 Bacteria 139035
2 Ga0055526_1000036 3300003771 Bacteria 135235
3 Ga0055526_1004917 3300003771 Bacteria 7858
4 Ga0055537_1000089 3300003773 Bacteria 66623
5 Ga0055524_1000184 3300003775 Bacteria 69474
6 Ga0055534_1000221 3300003784 Bacteria 41847
7 Ga0055528_1000004 3300003790 Bacteria 285772
8 Ga0055531_10023516 3300003794 Bacteria 2306
9 Ga0065704_10000605 3300005289 Bacteria 18366
10 Ga0065715_10033865 3300005293 Bacteria 1150
11 Ga0065715_10113947 3300005293 Bacteria 2469
12 Ga0065715_10127732 3300005293 Bacteria 2078
13 Ga0070670_100338331 3300005331 Bacteria 1321
14 Ga0070680_100677664 3300005336 Bacteria 887
15 Ga0070679_100065551 3300005530 Bacteria 3620
16 Ga0075365_10147836 3300006038 Bacteria 1634
17 Ga0075364_10001149 3300006051 Bacteria 14147
18 Ga0105248_10406920 3300009177 Bacteria 1532
19 Ga0105029_102917 3300009984 Bacteria 1125
20 Ga0157371_10000154 3300013102 Bacteria 100237
21 Ga0157370_10442568 3300013104 Bacteria 1195
22 Ga0157378_10020034 3300013297 Bacteria 5882
23 Ga0157372_10166035 3300013307 Bacteria 2553
24 Ga0183360_10001 3300015689 Bacteria 3943671
25 Ga0163161_10069390 3300017792 Bacteria 2576
26 Ga0209565_1000001 3300025263 Bacteria 2950419
27 Ga0209673_1000001 3300025273 Bacteria 3176258
28 Ga0209675_1000001 3300025291 Bacteria 2950293
29 Ga0209676_1000027 3300025292 Bacteria 560222
30 Ga0209025_1000015 3300025294 Bacteria 808120
31 Ga0209564_1000001 3300025295 Bacteria 3176258
32 Ga0209758_1015009 3300025297 Bacteria 4051
33 Ga0209256_1000002 3300025299 Bacteria 1906740
34 Ga0209257_1000148 3300025304 Bacteria 193131
35 Ga0207705_10256562 3300025909 Bacteria 1334
36 Ga0207650_10132571 3300025925 Bacteria 1952
37 Ga0207644_10212365 3300025931 Bacteria 1531
38 Ga0207668_10007047 3300025972 Bacteria 6669
39 Ga0314311_1227851 3300030733 Bacteria 2668
40 Ga0307408_100007697 3300031548 Bacteria 7128
41 Ga0307413_10075087 3300031824 Bacteria 2144
42 Ga0307413_10497937 3300031824 Bacteria 978
43 Ga0307406_10002735 3300031901 Bacteria 9620
44 Ga0307412_10098806 3300031911 Bacteria 2059
45 Ga0307414_10000812 3300032004 Bacteria 15935
46 Ga0307414_10002976 3300032004 Bacteria 8969
47 Ga0307414_10012294 3300032004 Bacteria 5055
48 Ga0307414_10034719 3300032004 Bacteria 3348
49 Ga0307414_10123962 3300032004 Bacteria 1992
50 Ga0307414_10140574 3300032004 Bacteria 1889
51 Ga0307414_10145851 3300032004 Bacteria 1859
52 Ga0373961_0082962 3300035241 Bacteria 1011
53 Ga0439436_0031091 3300041404 Bacteria 1550
54 Ga0439439_0010026 3300041406 Bacteria 2261
55 Ga0439447_004010 3300041407 Bacteria 5149
56 Ga0439465_0003446 3300041413 Bacteria 5163
57 Ga0439465_0005592 3300041413 Bacteria 4005
58 Ga0451793_0599211 3300041452 Bacteria 2663
59 Ga0451797_0269913 3300041453 Bacteria 2098
60 Ga0451795_1638473 3300041456 Bacteria 1015
61 Ga0451843_0793557 3300041509 Bacteria 1231
62 Ga0451843_1735489 3300041509 Bacteria 1947
63 Ga0439433_0040246 3300041999 Bacteria 1087
64 Ga0439445_0006336 3300042004 Bacteria 2717
65 Ga0439445_0013498 3300042004 Bacteria 1978
66 Ga0439445_0045152 3300042004 Bacteria 1178
67 Ga0439449_0003412 3300042007 Bacteria 6181
68 Ga0439449_0003785 3300042007 Bacteria 5854
69 Ga0439449_0015517 3300042007 Bacteria 2863
70 Ga0439449_0039644 3300042007 Bacteria 1751
71 Ga0495638_0030657 3300046460 Bacteria 3460
72 Ga0495616_0306201 3300046513 Bacteria 670
73 Ga0495633_0005989 3300046558 Bacteria 7306
74 Ga0495668_0002813 3300046616 Bacteria 13841
75 Ga0495671_0124613 3300046692 Bacteria 1256
76 Ga0496102_0329991 3300048905 Bacteria 1437
77 Ga0496114_0021107 3300048917 Bacteria 5295
78 Ga0496121_0000678 3300048924 Bacteria 63439
79 Ga0496122_0000196 3300048925 Bacteria 136499
80 Ga0496122_0036182 3300048925 Bacteria 3999
81 Ga0496123_0000128 3300048926 Bacteria 154836
82 Ga0496123_0285364 3300048926 Bacteria 795
83 Ga0496124_0072718 3300048927 Bacteria 2846
84 Ga0496124_0377611 3300048927 Bacteria 992
85 Ga0496125_0107091 3300048928 Bacteria 2038
86 Ga0501034_0000272 3300049571 Bacteria 93316
87 Ga0501034_0000316 3300049571 Bacteria 85497
88 Ga0501225_0003799 3300049705 Bacteria 4536
89 nmdc:mga00v17_3057_c1 3300050491 Bacteria 8601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042004 Ga0439445_0045152 Ga0439445_0045152_32_658 199
2 3300046513 Ga0495616_0306201 Ga0495616_0306201_34_660 204
3 3300025972 Ga0207668_10007047 Ga0207668_100070472 205
4 3300009177 Ga0105248_10406920 Ga0105248_104069202 206
5 iso_pu_bacteria 8002869464 8002871609 207
6 3300005331 Ga0070670_100338331 Ga0070670_1003383312 208
7 3300025925 Ga0207650_10132571 Ga0207650_101325713 208
8 3300030733 Ga0314311_1227851 Ga0314311_12278513 208
9 3300031548 Ga0307408_100007697 Ga0307408_1000076975 208
10 3300031901 Ga0307406_10002735 Ga0307406_1000273511 208
11 3300042004 Ga0439445_0006336 Ga0439445_0006336_1324_1977 208
12 3300049705 Ga0501225_0003799 Ga0501225_0003799_1611_2264 208
13 iso_pu_bacteria 2984514374 2984516643 208
14 3300013297 Ga0157378_10020034 Ga0157378_100200344 209
15 3300042007 Ga0439449_0039644 Ga0439449_0039644_336_1076 209
16 3300041509 Ga0451843_1735489 Ga0451843_1735489_1174_1830 211
17 3300042007 Ga0439449_0015517 Ga0439449_0015517_1688_2350 211
18 3300046558 Ga0495633_0005989 Ga0495633_0005989_1344_2006 211
19 3300048928 Ga0496125_0107091 Ga0496125_0107091_1224_1931 211
20 3300003771 Ga0055526_1004917 Ga0055526_10049174 212
21 3300006038 Ga0075365_10147836 Ga0075365_101478362 212
22 3300013102 Ga0157371_10000154 Ga0157371_1000015493 212
23 3300013104 Ga0157370_10442568 Ga0157370_104425682 212
24 3300017792 Ga0163161_10069390 Ga0163161_100693904 212
25 3300042007 Ga0439449_0003785 Ga0439449_0003785_3949_4662 212
26 3300048927 Ga0496124_0072718 Ga0496124_0072718_1056_1721 212
27 iso_pu_bacteria 2643221579 2643905637 212
28 iso_pu_bacteria 2643221581 2643913234 212
29 iso_pu_bacteria 2923516293 2923517742 212
30 3300048925 Ga0496122_0000196 Ga0496122_0000196_95981_96670 213
31 3300048926 Ga0496123_0000128 Ga0496123_0000128_95977_96666 213
32 iso_pu_bacteria 2643221559 2643816233 213
33 iso_pu_bacteria 2643221573 2643879584 213
34 iso_pu_bacteria 2643221586 2643939082 213
35 iso_pu_bacteria 2643221593 2643974504 213
36 iso_pu_bacteria 2643221612 2644077177 213
37 iso_pu_bacteria 2643221720 2644662807 213
38 iso_pu_bacteria 2643221727 2644694596 213
39 iso_pu_bacteria 2643221728 2644698238 213
40 iso_pu_bacteria 2941489479 2941489705 213
41 iso_pu_bacteria 2987605356 2987607442 213
42 iso_pu_bacteria 2995948881 2995950764 213
43 3300032004 Ga0307414_10002976 Ga0307414_100029768 214
44 3300006051 Ga0075364_10001149 Ga0075364_100011499 216
45 3300009984 Ga0105029_102917 Ga0105029_1029172 216
46 3300025292 Ga0209676_1000027 Ga0209676_100002711 216
47 3300032004 Ga0307414_10000812 Ga0307414_100008128 216
48 3300032004 Ga0307414_10012294 Ga0307414_100122942 216
49 3300032004 Ga0307414_10034719 Ga0307414_100347194 216
50 3300032004 Ga0307414_10123962 Ga0307414_101239622 216
51 3300041413 Ga0439465_0003446 Ga0439465_0003446_3963_4640 216
52 3300041413 Ga0439465_0005592 Ga0439465_0005592_2029_2691 216
53 3300041452 Ga0451793_0599211 Ga0451793_0599211_1930_2592 216
54 3300041453 Ga0451797_0269913 Ga0451797_0269913_1377_2039 216
55 3300041509 Ga0451843_0793557 Ga0451843_0793557_345_1007 216
56 3300042007 Ga0439449_0003412 Ga0439449_0003412_4986_5663 216
57 3300046460 Ga0495638_0030657 Ga0495638_0030657_108_770 216
58 3300046692 Ga0495671_0124613 Ga0495671_0124613_11_673 216
59 3300048905 Ga0496102_0329991 Ga0496102_0329991_663_1325 216
60 3300048917 Ga0496114_0021107 Ga0496114_0021107_4388_5065 216
61 3300048927 Ga0496124_0377611 Ga0496124_0377611_87_749 216
62 3300049571 Ga0501034_0000272 Ga0501034_0000272_4373_5050 216
63 3300050491 nmdc:mga00v17_3057_c1 nmdc:mga00v17_3057_c1_5107_5772 216
64 3300003187 JGI25151J46595_10000070 JGI25151J46595_1000007023 217
65 3300003771 Ga0055526_1000036 Ga0055526_100003619 217
66 3300003773 Ga0055537_1000089 Ga0055537_100008919 217
67 3300003775 Ga0055524_1000184 Ga0055524_100018419 217
68 3300003784 Ga0055534_1000221 Ga0055534_100022126 217
69 3300003790 Ga0055528_1000004 Ga0055528_1000004164 217
70 3300003794 Ga0055531_10023516 Ga0055531_100235163 217
71 3300005289 Ga0065704_10000605 Ga0065704_1000060514 217
72 3300005293 Ga0065715_10033865 Ga0065715_100338652 217
73 3300005293 Ga0065715_10113947 Ga0065715_101139474 217
74 3300005293 Ga0065715_10127732 Ga0065715_101277322 217
75 3300005336 Ga0070680_100677664 Ga0070680_1006776641 217
76 3300005530 Ga0070679_100065551 Ga0070679_1000655514 217
77 3300013307 Ga0157372_10166035 Ga0157372_101660353 217
78 3300015689 Ga0183360_10001 Ga0183360_100012393 217
79 3300025263 Ga0209565_1000001 Ga0209565_10000011464 217
80 3300025273 Ga0209673_1000001 Ga0209673_10000011464 217
81 3300025291 Ga0209675_1000001 Ga0209675_10000011070 217
82 3300025294 Ga0209025_1000015 Ga0209025_100001579 217
83 3300025295 Ga0209564_1000001 Ga0209564_10000011232 217
84 3300025297 Ga0209758_1015009 Ga0209758_10150093 217
85 3300025299 Ga0209256_1000002 Ga0209256_1000002322 217
86 3300025304 Ga0209257_1000148 Ga0209257_100014830 217
87 3300025909 Ga0207705_10256562 Ga0207705_102565621 217
88 3300025931 Ga0207644_10212365 Ga0207644_102123652 217
89 3300031824 Ga0307413_10075087 Ga0307413_100750873 217
90 3300031824 Ga0307413_10497937 Ga0307413_104979372 217
91 3300031911 Ga0307412_10098806 Ga0307412_100988062 217
92 3300032004 Ga0307414_10140574 Ga0307414_101405742 217
93 3300032004 Ga0307414_10145851 Ga0307414_101458512 217
94 3300035241 Ga0373961_0082962 Ga0373961_0082962_291_992 217
95 3300041404 Ga0439436_0031091 Ga0439436_0031091_365_1018 217
96 3300041406 Ga0439439_0010026 Ga0439439_0010026_186_851 217
97 3300041407 Ga0439447_004010 Ga0439447_004010_3639_4295 217
98 3300041456 Ga0451795_1638473 Ga0451795_1638473_60_734 217
99 3300041999 Ga0439433_0040246 Ga0439433_0040246_390_1055 217
100 3300042004 Ga0439445_0013498 Ga0439445_0013498_839_1504 217
101 3300046616 Ga0495668_0002813 Ga0495668_0002813_7097_7753 217
102 3300048924 Ga0496121_0000678 Ga0496121_0000678_62155_62814 217
103 3300048925 Ga0496122_0036182 Ga0496122_0036182_1081_1827 217
104 3300048926 Ga0496123_0285364 Ga0496123_0285364_34_780 217
105 3300049571 Ga0501034_0000316 Ga0501034_0000316_78615_79319 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

33

213

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kg3-assembly2.cif.gz_C crystal structure of nicotinic acid mononucleotide adenylyltransferase mutant p22k/y84v/y118d/c132q/w176f from escherichia coli 0.9331 1 207
1k4k-assembly1.cif.gz_A crystal structure of e. coli nicotinic acid mononucleotide adenylyltransferase 0.9302 1 207
6kh2-assembly3.cif.gz_C crystal structure of nicotinic acid mononucleotide adenylyltransferase mutant p22k/y84v/y118d/c132l/w176y from escherichia coli 0.927 1 207
5deo-assembly1.cif.gz_A mycobacterium abscessus nadd in complex with nicotinic acid adenine dinucleotide 0.9206 2 207
5deo-assembly2.cif.gz_C mycobacterium abscessus nadd in complex with nicotinic acid adenine dinucleotide 0.919 1 207
ID Description Score Start End Superfamily
5virA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9039 1 207 3.40.50.620
1k4kB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9008 1 207 3.40.50.620
5virA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8945 1 207 3.40.50.620
1k4kB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8924 1 207 3.40.50.620
2h2aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8773 1 207 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1M4ZZM6-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9557 3 207 GO:0004515
GO:0005524
GO:0009435
AF-A0A2D4S499-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9531 2 207 GO:0004515
GO:0005524
GO:0009435
AF-A0A4R1F326-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9458 4 208 GO:0004515
GO:0005524
GO:0009435
AF-A0A7V8ZNF0-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9452 2 207 GO:0004515
GO:0005524
GO:0009435
AF-R4HZH6-F1-model_v4 deleted 0.9449 3 207

Feature Viewer

pLDDT pTM Quality
89.5 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map