F029222

General Info

Members Datasets Scaffolds Average Seq Length
104 84 58 296

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2563366752|2563930643
Length 314
Sequence TSNMMSSQLMLNLNRNALQMNNTQNQLATGRKLNKPSDDPVGITYSLRYRGELASNEQYTKNVDGALSWLDFNDTVLNQAGDVVQRLRQLTVQASTGSNPQSALDSIKQEVGQLKEQLLDIANSKLNGKYIFNGETYDKKPYDFPKNADGTTNTTGLNADGTSNDKSMATLETDKGMIYYSVGESVQLPINLTGTDIFGNGGDPDNIFNIMDALTQSLTDGNFKGMTEQLDKIDSRMETILTTRAELGAKTNRIELMQGRLSDLNTNLTDLQSKTEDADYAELIMKSKIQENIYNASLSAGSKIIQPTLVDFLR

Samples

Sample ID Description Type Environment
1 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
2 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
3 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
4 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
5 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
6 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
7 2671180694 Paenibacillus sp. A3 Isolate Unclassified
8 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
9 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
10 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
11 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
12 2857472729 Cohnella sp. R-74144 Isolate Unclassified
13 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
14 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
15 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
16 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
17 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
18 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
19 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
20 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
21 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
22 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
23 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
24 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
25 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
26 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
27 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
28 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
29 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
30 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
31 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
32 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
33 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
34 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
35 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
36 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
37 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
38 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
39 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
40 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
41 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
42 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
45 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
46 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
61 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
62 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
63 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
64 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
67 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
68 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
69 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
70 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
71 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
72 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
78 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
79 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
80 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
81 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
82 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
83 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
84 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 55.77
Metatranscriptomes 0
Isolates 44.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.27
Nodule 0.96
Rhizoplane 0.96
Rhizosphere 45.19
Stem 0
Stem Tuber 0
Unclassified 34.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1004321 3300002737 Bacteria 3373
2 JGI25151J46595_10001734 3300003187 Bacteria 14175
3 JGI25151J46595_10009486 3300003187 Bacteria 4602
4 Ga0055538_1000452 3300003751 Bacteria 15491
5 Ga0055535_1009351 3300003761 Bacteria 1696
6 Ga0055541_1000196 3300003841 Bacteria 26396
7 Ga0055541_1000806 3300003841 Bacteria 7747
8 Ga0105251_10004765 3300009011 Bacteria 9082
9 Ga0105244_10026044 3300009036 Bacteria 3170
10 Ga0105244_10036868 3300009036 Bacteria 2558
11 Ga0105244_10042253 3300009036 Bacteria 2358
12 Ga0114129_10230885 3300009147 Bacteria 2492
13 Ga0105246_10000485 3300011119 Bacteria 21476
14 Ga0157371_10210078 3300013102 Bacteria 1396
15 Ga0209784_100075 3300025224 Bacteria 139902
16 Ga0209784_100485 3300025224 Bacteria 15977
17 Ga0209566_100091 3300025225 Bacteria 141100
18 Ga0209566_100387 3300025225 Bacteria 35683
19 Ga0209566_100891 3300025225 Bacteria 14380
20 Ga0209566_102244 3300025225 Bacteria 3780
21 Ga0209437_100453 3300025233 Bacteria 33692
22 Ga0209258_101334 3300025242 Bacteria 9094
23 Ga0209676_1005597 3300025292 Bacteria 6490
24 Ga0209025_1002667 3300025294 Bacteria 18226
25 Ga0209025_1003725 3300025294 Bacteria 14000
26 Ga0209025_1009550 3300025294 Bacteria 6737
27 Ga0207655_1015571 3300025728 Bacteria 4215
28 Ga0395899_0000860 3300037312 Bacteria 28994
29 Ga0395899_0003246 3300037312 Bacteria 12886
30 Ga0439436_0001040 3300041404 Bacteria 7791
31 Ga0439439_0000909 3300041406 Bacteria 5471
32 Ga0439433_0015175 3300041999 Unclassified 1700
33 Ga0439449_0001353 3300042007 Bacteria 9610
34 Ga0439449_0061638 3300042007 Unclassified 1384
35 Ga0439462_0000731 3300042015 Bacteria 6789
36 Ga0453684_0024561 3300044712 Bacteria 8803
37 Ga0496116_0002717 3300048919 Bacteria 18216
38 Ga0496116_0006506 3300048919 Bacteria 10587
39 Ga0496116_0059469 3300048919 Bacteria 2485
40 Ga0496121_0075499 3300048924 Bacteria 2692
41 Ga0496121_0125946 3300048924 Bacteria 1926
42 Ga0496122_0122607 3300048925 Unclassified 1672
43 Ga0496122_0169325 3300048925 Unclassified 1319
44 Ga0496123_0036068 3300048926 Unclassified 3513
45 Ga0496124_0001688 3300048927 Bacteria 31277
46 Ga0496124_0025827 3300048927 Bacteria 5310
47 Ga0496125_0001318 3300048928 Bacteria 36700
48 Ga0496125_0101279 3300048928 Unclassified 2120
49 Ga0496125_0131051 3300048928 Unclassified 1765
50 Ga0496126_0005151 3300048929 Bacteria 15119
51 Ga0496126_0372540 3300048929 Bacteria 1164
52 Ga0501036_0278545 3300049572 Bacteria 1400
53 Ga0501040_0352764 3300049576 Bacteria 1054
54 Ga0501042_0241844 3300049578 Bacteria 1302
55 Ga0501047_0015856 3300049581 Bacteria 7180
56 Ga0501070_0020875 3300049586 Bacteria 5495
57 Ga0501079_0275524 3300049741 Bacteria 1315
58 nmdc:mga05p37_602020_c1 3300050507 Bacteria 1240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10210078 Ga0157371_102100782 220
2 3300048919 Ga0496116_0059469 Ga0496116_0059469_1136_1987 232
3 3300048927 Ga0496124_0025827 Ga0496124_0025827_3617_4468 232
4 iso_pu_bacteria 8046991243 8046997173 239
5 3300025728 Ga0207655_1015571 Ga0207655_10155712 241
6 3300048924 Ga0496121_0075499 Ga0496121_0075499_38_892 241
7 3300048929 Ga0496126_0372540 Ga0496126_0372540_246_1100 241
8 3300044712 Ga0453684_0024561 Ga0453684_0024561_3367_4245 246
9 3300048928 Ga0496125_0131051 Ga0496125_0131051_400_1308 246
10 iso_pu_bacteria 2936361878 2936365848 247
11 iso_pu_bacteria 2929297113 2929299401 249
12 iso_pu_bacteria 8055632911 8055633222 249
13 iso_pu_bacteria 2925326138 2925329310 250
14 iso_pu_bacteria 2929206907 2929207018 250
15 iso_pu_bacteria 8054795415 8054799076 250
16 iso_pu_bacteria 2643221543 2643736934 251
17 iso_pu_bacteria 2643221676 2644423371 251
18 iso_pu_bacteria 2671180694 2673818611 251
19 iso_pu_bacteria 2857472729 2857477449 251
20 iso_pu_bacteria 2864997549 2865000926 251
21 iso_pu_bacteria 2919425241 2919430570 251
22 iso_pu_bacteria 8002317523 8002322139 251
23 3300048919 Ga0496116_0006506 Ga0496116_0006506_8523_9440 252
24 3300048929 Ga0496126_0005151 Ga0496126_0005151_6877_7764 252
25 iso_pu_bacteria 2857453340 2857459112 252
26 iso_pu_bacteria 2971410472 2971416612 252
27 iso_pu_bacteria 8056533031 8056536048 252
28 3300003187 JGI25151J46595_10001734 JGI25151J46595_100017344 253
29 3300003761 Ga0055535_1009351 Ga0055535_10093512 253
30 3300003841 Ga0055541_1000196 Ga0055541_100019616 253
31 3300003841 Ga0055541_1000806 Ga0055541_10008062 253
32 3300009147 Ga0114129_10230885 Ga0114129_102308854 253
33 3300025225 Ga0209566_100091 Ga0209566_10009187 253
34 3300025225 Ga0209566_100387 Ga0209566_10038713 253
35 3300025292 Ga0209676_1005597 Ga0209676_10055976 253
36 3300025294 Ga0209025_1003725 Ga0209025_10037254 253
37 3300041404 Ga0439436_0001040 Ga0439436_0001040_2139_3038 253
38 3300041406 Ga0439439_0000909 Ga0439439_0000909_3310_4209 253
39 3300041999 Ga0439433_0015175 Ga0439433_0015175_505_1404 253
40 3300042007 Ga0439449_0001353 Ga0439449_0001353_4101_5000 253
41 3300042015 Ga0439462_0000731 Ga0439462_0000731_5579_6478 253
42 3300050507 nmdc:mga05p37_602020_c1 nmdc:mga05p37_602020_c1_46_948 253
43 iso_pu_bacteria 2889042446 2889048114 253
44 3300003187 JGI25151J46595_10009486 JGI25151J46595_100094864 254
45 3300003751 Ga0055538_1000452 Ga0055538_100045215 254
46 3300025224 Ga0209784_100075 Ga0209784_10007536 254
47 3300025224 Ga0209784_100485 Ga0209784_10048515 254
48 3300025225 Ga0209566_100891 Ga0209566_1008913 254
49 3300025242 Ga0209258_101334 Ga0209258_1013342 254
50 3300025294 Ga0209025_1002667 Ga0209025_10026676 254
51 3300049572 Ga0501036_0278545 Ga0501036_0278545_268_1167 254
52 3300049576 Ga0501040_0352764 Ga0501040_0352764_135_1034 254
53 3300049578 Ga0501042_0241844 Ga0501042_0241844_130_1029 254
54 3300049581 Ga0501047_0015856 Ga0501047_0015856_1453_2352 254
55 3300049586 Ga0501070_0020875 Ga0501070_0020875_35_934 254
56 3300049741 Ga0501079_0275524 Ga0501079_0275524_142_1041 254
57 iso_pu_bacteria 2907202186 2907207273 254
58 3300025294 Ga0209025_1009550 Ga0209025_10095507 255
59 iso_pu_bacteria 2571042588 2573036599 255
60 iso_pu_bacteria 2791355222 2793185597 255
61 iso_pu_bacteria 2888578766 2888584569 255
62 iso_pu_bacteria 2889049205 2889052993 255
63 iso_pu_bacteria 2904113452 2904117872 255
64 iso_pu_bacteria 2904162308 2904168037 255
65 3300009011 Ga0105251_10004765 Ga0105251_100047655 257
66 3300009036 Ga0105244_10036868 Ga0105244_100368682 257
67 3300009036 Ga0105244_10042253 Ga0105244_100422532 257
68 3300011119 Ga0105246_10000485 Ga0105246_1000048512 257
69 3300025225 Ga0209566_102244 Ga0209566_1022442 257
70 3300037312 Ga0395899_0000860 Ga0395899_0000860_25785_26693 257
71 3300037312 Ga0395899_0003246 Ga0395899_0003246_11847_12755 257
72 3300042007 Ga0439449_0061638 Ga0439449_0061638_350_1258 257
73 3300048919 Ga0496116_0002717 Ga0496116_0002717_13097_13999 257
74 3300048924 Ga0496121_0125946 Ga0496121_0125946_542_1444 257
75 3300048925 Ga0496122_0122607 Ga0496122_0122607_552_1469 257
76 3300048925 Ga0496122_0169325 Ga0496122_0169325_204_1121 257
77 3300048926 Ga0496123_0036068 Ga0496123_0036068_2360_3277 257
78 3300048927 Ga0496124_0001688 Ga0496124_0001688_3974_4891 257
79 3300048928 Ga0496125_0001318 Ga0496125_0001318_763_1680 257
80 3300048928 Ga0496125_0101279 Ga0496125_0101279_763_1680 257
81 iso_pu_bacteria 2938649242 2938652569 258
82 iso_pu_bacteria 2968558590 2968559269 258
83 iso_pu_bacteria 2971511577 2971514380 258
84 iso_pu_bacteria 2980176882 2980180594 258
85 iso_pu_bacteria 2988225383 2988227449 258
86 iso_pu_bacteria 2996632988 2996637791 258
87 iso_pu_bacteria 2576861424 2578339023 259
88 iso_pu_bacteria 2600255286 2601640426 259
89 iso_pu_bacteria 2728369359 2730136937 259
90 iso_pu_bacteria 2821111986 2821116773 259
91 iso_pu_bacteria 2881636855 2881638029 259
92 iso_pu_bacteria 2885526491 2885532574 259
93 iso_pu_bacteria 2904490793 2904494382 259
94 iso_pu_bacteria 2919160200 2919165090 259
95 iso_pu_bacteria 2931384279 2931385229 259
96 iso_pu_bacteria 2939679117 2939680598 259
97 iso_pu_bacteria 2939702853 2939702871 259
98 iso_pu_bacteria 2945991243 2945996137 259
99 iso_pu_bacteria 2946053406 2946058829 259
100 iso_pu_bacteria 2971403814 2971410359 259
101 iso_pu_bacteria 2563366752 2563930643 260
102 3300002737 JGI25162J39368_1004321 JGI25162J39368_10043215 263
103 3300009036 Ga0105244_10026044 Ga0105244_100260442 263
104 3300025233 Ga0209437_100453 Ga0209437_1004538 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00669

Flagellin_N

Bacterial flagellin N-terminal helical region

1

136

0.98

PF00700

Flagellin_C

Bacterial flagellin C-terminal helical region

230

313

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ziy-assembly3.cif.gz_B crystal structure of bacillus cereus flgl 0.9035 57 257
3v47-assembly1.cif.gz_D crystal structure of the n-terminal fragment of zebrafish tlr5 in complex with salmonella flagellin 0.8894 63 186
5ziy-assembly3.cif.gz_B crystal structure of bacillus cereus flgl 0.8891 57 257
3v47-assembly1.cif.gz_C crystal structure of the n-terminal fragment of zebrafish tlr5 in complex with salmonella flagellin 0.8878 64 186
1io1-assembly1.cif.gz_A crystal structure of f41 fragment of flagellin 0.8866 57 186
ID Description Score Start End Superfamily
3v47D01 Mainly Alpha;Up-down Bundle;f41 fragment of flagellin, N-terminal domain;f41 fragment of flagellin, N-terminal domain 0.8478 63 255 1.20.1330.10
5gy2D00 Mainly Alpha;Up-down Bundle;f41 fragment of flagellin, N-terminal domain;f41 fragment of flagellin, N-terminal domain 0.8188 55 253 1.20.1330.10
5gy2D00 Mainly Alpha;Up-down Bundle;f41 fragment of flagellin, N-terminal domain;f41 fragment of flagellin, N-terminal domain 0.8017 55 253 1.20.1330.10
3v47D01 Mainly Alpha;Up-down Bundle;f41 fragment of flagellin, N-terminal domain;f41 fragment of flagellin, N-terminal domain 0.7894 63 255 1.20.1330.10
2d4xA00 Mainly Alpha;Up-down Bundle;f41 fragment of flagellin, N-terminal domain;f41 fragment of flagellin, N-terminal domain 0.7741 50 251 1.20.1330.10
ID Description Score Start End GO Terms
AF-A0A7W5AXA3-F1-model_v4 Flagellin 0.9271 51 258 GO:0005198
GO:0005576
GO:0009288
AF-A0A2A5K3B2-F1-model_v4 deleted 0.9264 29 256
AF-A0A4V1T519-F1-model_v4 deleted 0.9166 57 260
AF-A0A644YH30-F1-model_v4 Flagellin C-terminal domain-containing protein 0.8792 51 256 GO:0005198
GO:0009288
AF-A0A353T4K3-F1-model_v4 Flagellin 0.8662 53 261 GO:0005198
GO:0005576
GO:0009288

Feature Viewer

pLDDT pTM Quality
81.29 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map