F012903

General Info

Members Datasets Scaffolds Average Seq Length
102 70 102 123

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100001029|Ga0068869_10000102915
Length 137
Sequence MLLFLRALFLVIIASMLAATGWASARCALFAIPREVFTHPWFIATLFDAYWAFVTFYVWVAWKEQSAAARILWFVAIILWGNLAMATYMLIELFRIQKSDQLGEVFATRRPGKLTLPAILSMLGLVVYLLGAGSLFA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
23 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
24 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
39 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
40 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
41 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
42 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
43 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
44 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
45 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
46 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
55 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
56 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
64 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
65 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
66 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
68 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
69 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
70 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0
Rhizoplane 0
Rhizosphere 97.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10771347 3300005327 Unclassified 835
2 Ga0068869_100001029 3300005334 Bacteria 16228
3 Ga0070666_11170794 3300005335 Bacteria 572
4 Ga0068868_100005352 3300005338 Bacteria 9012
5 Ga0070701_10312649 3300005438 Unclassified 969
6 Ga0070708_101462255 3300005445 Unclassified 637
7 Ga0070678_101908886 3300005456 Unclassified 561
8 Ga0068867_100000101 3300005459 Bacteria 54858
9 Ga0068853_100319802 3300005539 Bacteria 1438
10 Ga0070672_100434261 3300005543 Unclassified 1129
11 Ga0068855_100864741 3300005563 Bacteria 957
12 Ga0068859_100376952 3300005617 Bacteria 1514
13 Ga0068859_100763905 3300005617 Bacteria 1055
14 Ga0068859_100887252 3300005617 Bacteria 977
15 Ga0068864_100264075 3300005618 Unclassified 1602
16 Ga0068858_100013998 3300005842 Bacteria 7570
17 Ga0068860_100095980 3300005843 Bacteria 2826
18 Ga0068860_100786876 3300005843 Bacteria 964
19 Ga0097621_100005559 3300006237 Bacteria 8886
20 Ga0097621_100050166 3300006237 Bacteria 3393
21 Ga0097621_100506974 3300006237 Unclassified 1094
22 Ga0068871_100001232 3300006358 Bacteria 17079
23 Ga0097620_100270018 3300006931 Unclassified 1793
24 Ga0097620_100376927 3300006931 Bacteria 1514
25 Ga0097620_100763948 3300006931 Bacteria 1055
26 Ga0097620_100887036 3300006931 Bacteria 977
27 Ga0105240_10250159 3300009093 Bacteria 2050
28 Ga0105242_13323884 3300009176 Bacteria 500
29 Ga0105237_10492224 3300009545 Bacteria 1233
30 Ga0157374_10000030 3300013296 Bacteria 211102
31 Ga0157374_11703434 3300013296 Unclassified 655
32 Ga0163162_10185053 3300013306 Bacteria 2210
33 Ga0157377_10378254 3300014745 Unclassified 958
34 Ga0157376_10000956 3300014969 Bacteria 18831
35 Ga0207680_10585149 3300025903 Bacteria 798
36 Ga0207705_10001619 3300025909 Bacteria 17873
37 Ga0207695_10224870 3300025913 Unclassified 1783
38 Ga0207671_10308648 3300025914 Unclassified 1250
39 Ga0207650_10089008 3300025925 Bacteria 2355
40 Ga0207689_10000102 3300025942 Bacteria 69286
41 Ga0207677_11348196 3300026023 Bacteria 656
42 Ga0207703_10172006 3300026035 Bacteria 1906
43 Ga0207639_10358159 3300026041 Bacteria 1305
44 Ga0207641_10513712 3300026088 Bacteria 1165
45 Ga0207648_10009282 3300026089 Bacteria 9437
46 Ga0268264_10224023 3300028381 Bacteria 1733
47 Ga0265319_1002477 3300028563 Bacteria 10062
48 Ga0265319_1022011 3300028563 Bacteria 2331
49 Ga0265319_1036088 3300028563 Unclassified 1693
50 Ga0265319_1037050 3300028563 Bacteria 1664
51 Ga0265323_10001301 3300028653 Bacteria 12465
52 Ga0265323_10012003 3300028653 Unclassified 3481
53 Ga0265338_10021782 3300028800 Bacteria 6662
54 Ga0265324_10041010 3300029957 Bacteria 1603
55 Ga0265330_10015839 3300031235 Unclassified 3483
56 Ga0265330_10205036 3300031235 Bacteria 833
57 Ga0265332_10190219 3300031238 Bacteria 854
58 Ga0265328_10348677 3300031239 Bacteria 576
59 Ga0265320_10000046 3300031240 Bacteria 119672
60 Ga0265320_10001782 3300031240 Bacteria 15241
61 Ga0265320_10050114 3300031240 Bacteria 2031
62 Ga0265320_10145282 3300031240 Bacteria 1073
63 Ga0265340_10122265 3300031247 Bacteria 1197
64 Ga0265331_10048837 3300031250 Bacteria 2033
65 Ga0265327_10000281 3300031251 Bacteria 100389
66 Ga0265327_10037588 3300031251 Bacteria 2649
67 Ga0265327_10041822 3300031251 Bacteria 2465
68 Ga0265327_10051037 3300031251 Bacteria 2161
69 Ga0265316_10051438 3300031344 Bacteria 3236
70 Ga0265316_10617426 3300031344 Bacteria 768
71 Ga0265314_10006045 3300031711 Bacteria 10773
72 Ga0265314_10243373 3300031711 Bacteria 1036
73 Ga0265314_10258515 3300031711 Bacteria 996
74 Ga0265342_10114166 3300031712 Unclassified 1526
75 Ga0265342_10139152 3300031712 Bacteria 1355
76 Ga0265342_10183658 3300031712 Bacteria 1144
77 Ga0265342_10390370 3300031712 Bacteria 720
78 Ga0307416_100642671 3300032002 Bacteria 1145
79 Ga0307414_10651118 3300032004 Bacteria 950
80 Ga0373949_0276321 3300035090 Bacteria 527
81 Ga0373931_0365082 3300035691 Bacteria 907
82 Ga0373935_1168916 3300035692 Bacteria 573
83 Ga0373927_0233591 3300035695 Bacteria 1208
84 Ga0373937_1114878 3300036401 Bacteria 738
85 Ga0439444_0007239 3300042437 Bacteria 1699
86 Ga0451577_0198709 3300042876 Bacteria 1810
87 Ga0451577_0268770 3300042876 Bacteria 1544
88 Ga0451577_0952788 3300042876 Bacteria 772
89 Ga0451577_1075109 3300042876 Bacteria 721
90 Ga0451577_2026534 3300042876 Unclassified 503
91 Ga0501034_0197666 3300049571 Bacteria 1970
92 Ga0501034_0970213 3300049571 Unclassified 735
93 Ga0501046_0031164 3300049580 Bacteria 4325
94 Ga0501070_0495507 3300049586 Unclassified 982
95 Ga0501257_100333 3300049686 Bacteria 760
96 Ga0501083_0030935 3300049744 Bacteria 3674
97 Ga0501035_0001662 3300049822 Bacteria 22483
98 Ga0501044_0017359 3300049823 Bacteria 7720
99 Ga0501044_0959922 3300049823 Unclassified 728
100 Ga0500568_0377689 3300053139 Unclassified 513
101 Ga0500616_0002839 3300053153 Bacteria 13928
102 Ga0500622_0298994 3300053156 Bacteria 687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005456 Ga0070678_101908886 Ga0070678_1019088862 95
2 3300006237 Ga0097621_100506974 Ga0097621_1005069742 95
3 3300049822 Ga0501035_0001662 Ga0501035_0001662_16223_16585 95
4 3300029957 Ga0265324_10041010 Ga0265324_100410102 96
5 3300028653 Ga0265323_10001301 Ga0265323_100013015 100
6 3300031712 Ga0265342_10390370 Ga0265342_103903701 100
7 3300005445 Ga0070708_101462255 Ga0070708_1014622552 101
8 3300013296 Ga0157374_11703434 Ga0157374_117034342 102
9 3300032002 Ga0307416_100642671 Ga0307416_1006426712 109
10 3300042876 Ga0451577_0952788 Ga0451577_0952788_295_711 109
11 3300005327 Ga0070658_10771347 Ga0070658_107713472 110
12 3300005334 Ga0068869_100001029 Ga0068869_10000102915 110
13 3300005335 Ga0070666_11170794 Ga0070666_111707941 110
14 3300005338 Ga0068868_100005352 Ga0068868_1000053526 110
15 3300005438 Ga0070701_10312649 Ga0070701_103126492 110
16 3300005459 Ga0068867_100000101 Ga0068867_10000010113 110
17 3300005539 Ga0068853_100319802 Ga0068853_1003198022 110
18 3300005543 Ga0070672_100434261 Ga0070672_1004342612 110
19 3300005563 Ga0068855_100864741 Ga0068855_1008647411 110
20 3300005617 Ga0068859_100376952 Ga0068859_1003769522 110
21 3300005617 Ga0068859_100763905 Ga0068859_1007639052 110
22 3300005617 Ga0068859_100887252 Ga0068859_1008872521 110
23 3300005618 Ga0068864_100264075 Ga0068864_1002640752 110
24 3300005842 Ga0068858_100013998 Ga0068858_1000139983 110
25 3300005843 Ga0068860_100095980 Ga0068860_1000959804 110
26 3300005843 Ga0068860_100786876 Ga0068860_1007868761 110
27 3300006237 Ga0097621_100005559 Ga0097621_1000055592 110
28 3300006237 Ga0097621_100050166 Ga0097621_1000501663 110
29 3300006358 Ga0068871_100001232 Ga0068871_1000012326 110
30 3300006931 Ga0097620_100270018 Ga0097620_1002700182 110
31 3300006931 Ga0097620_100376927 Ga0097620_1003769272 110
32 3300006931 Ga0097620_100763948 Ga0097620_1007639482 110
33 3300006931 Ga0097620_100887036 Ga0097620_1008870361 110
34 3300009093 Ga0105240_10250159 Ga0105240_102501592 110
35 3300009176 Ga0105242_13323884 Ga0105242_133238841 110
36 3300009545 Ga0105237_10492224 Ga0105237_104922242 110
37 3300013296 Ga0157374_10000030 Ga0157374_1000003014 110
38 3300013306 Ga0163162_10185053 Ga0163162_101850534 110
39 3300014745 Ga0157377_10378254 Ga0157377_103782542 110
40 3300014969 Ga0157376_10000956 Ga0157376_100009562 110
41 3300025903 Ga0207680_10585149 Ga0207680_105851492 110
42 3300025909 Ga0207705_10001619 Ga0207705_100016192 110
43 3300025913 Ga0207695_10224870 Ga0207695_102248702 110
44 3300025914 Ga0207671_10308648 Ga0207671_103086482 110
45 3300025925 Ga0207650_10089008 Ga0207650_100890082 110
46 3300025942 Ga0207689_10000102 Ga0207689_100001025 110
47 3300026023 Ga0207677_11348196 Ga0207677_113481961 110
48 3300026035 Ga0207703_10172006 Ga0207703_101720063 110
49 3300026041 Ga0207639_10358159 Ga0207639_103581592 110
50 3300026088 Ga0207641_10513712 Ga0207641_105137122 110
51 3300026089 Ga0207648_10009282 Ga0207648_100092822 110
52 3300028381 Ga0268264_10224023 Ga0268264_102240233 110
53 3300028563 Ga0265319_1002477 Ga0265319_10024774 110
54 3300028563 Ga0265319_1022011 Ga0265319_10220112 110
55 3300028563 Ga0265319_1036088 Ga0265319_10360883 110
56 3300028563 Ga0265319_1037050 Ga0265319_10370502 110
57 3300028653 Ga0265323_10012003 Ga0265323_100120033 110
58 3300028800 Ga0265338_10021782 Ga0265338_100217826 110
59 3300031235 Ga0265330_10015839 Ga0265330_100158393 110
60 3300031235 Ga0265330_10205036 Ga0265330_102050362 110
61 3300031238 Ga0265332_10190219 Ga0265332_101902192 110
62 3300031239 Ga0265328_10348677 Ga0265328_103486771 110
63 3300031240 Ga0265320_10000046 Ga0265320_1000004672 110
64 3300031240 Ga0265320_10001782 Ga0265320_1000178212 110
65 3300031240 Ga0265320_10050114 Ga0265320_100501142 110
66 3300031240 Ga0265320_10145282 Ga0265320_101452822 110
67 3300031247 Ga0265340_10122265 Ga0265340_101222653 110
68 3300031250 Ga0265331_10048837 Ga0265331_100488373 110
69 3300031251 Ga0265327_10000281 Ga0265327_1000028122 110
70 3300031251 Ga0265327_10037588 Ga0265327_100375882 110
71 3300031251 Ga0265327_10041822 Ga0265327_100418222 110
72 3300031251 Ga0265327_10051037 Ga0265327_100510372 110
73 3300031344 Ga0265316_10051438 Ga0265316_100514383 110
74 3300031344 Ga0265316_10617426 Ga0265316_106174262 110
75 3300031711 Ga0265314_10006045 Ga0265314_100060455 110
76 3300031711 Ga0265314_10243373 Ga0265314_102433732 110
77 3300031711 Ga0265314_10258515 Ga0265314_102585152 110
78 3300031712 Ga0265342_10114166 Ga0265342_101141662 110
79 3300031712 Ga0265342_10139152 Ga0265342_101391522 110
80 3300031712 Ga0265342_10183658 Ga0265342_101836582 110
81 3300032004 Ga0307414_10651118 Ga0307414_106511182 110
82 3300035090 Ga0373949_0276321 Ga0373949_0276321_16_423 110
83 3300035691 Ga0373931_0365082 Ga0373931_0365082_378_785 110
84 3300035692 Ga0373935_1168916 Ga0373935_1168916_105_512 110
85 3300035695 Ga0373927_0233591 Ga0373927_0233591_35_442 110
86 3300036401 Ga0373937_1114878 Ga0373937_1114878_291_698 110
87 3300042437 Ga0439444_0007239 Ga0439444_0007239_440_853 110
88 3300042876 Ga0451577_0198709 Ga0451577_0198709_1271_1666 110
89 3300042876 Ga0451577_0268770 Ga0451577_0268770_454_849 110
90 3300042876 Ga0451577_1075109 Ga0451577_1075109_171_575 110
91 3300042876 Ga0451577_2026534 Ga0451577_2026534_46_441 110
92 3300049571 Ga0501034_0197666 Ga0501034_0197666_165_509 110
93 3300049571 Ga0501034_0970213 Ga0501034_0970213_209_541 110
94 3300049580 Ga0501046_0031164 Ga0501046_0031164_2107_2514 110
95 3300049586 Ga0501070_0495507 Ga0501070_0495507_241_642 110
96 3300049686 Ga0501257_100333 Ga0501257_100333_188_628 110
97 3300049744 Ga0501083_0030935 Ga0501083_0030935_2704_3099 110
98 3300049823 Ga0501044_0017359 Ga0501044_0017359_5400_5795 110
99 3300049823 Ga0501044_0959922 Ga0501044_0959922_210_548 110
100 3300053139 Ga0500568_0377689 Ga0500568_0377689_109_441 110
101 3300053153 Ga0500616_0002839 Ga0500616_0002839_1200_1532 110
102 3300053156 Ga0500622_0298994 Ga0500622_0298994_253_651 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07343

DUF1475

Protein of unknown function (DUF1475)

1

110

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dce-assembly1.cif.gz_X cryo-em structure of human xkr8-basigin complex bound to fab fragment 0.3551 2 105
7dce-assembly1.cif.gz_X cryo-em structure of human xkr8-basigin complex bound to fab fragment 0.3388 2 105
ID Description Score Start End Superfamily
af_Q9VBM5_98_239_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4173 4 107 1.10.287.70
3etuA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3806 44 98 1.10.287.3290
3dfzB02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;SirC, precorrin-2 dehydrogenase, C-terminal helical domain-like 0.3686 38 95 1.10.8.610
af_Q9VBM5_98_239_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3587 4 107 1.10.287.70
3dfzB02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;SirC, precorrin-2 dehydrogenase, C-terminal helical domain-like 0.3152 38 95 1.10.8.610
ID Description Score Start End GO Terms
AF-A0A2G4I9R1-F1-model_v4 DUF1475 domain-containing protein 1 1 110 GO:0016020
AF-A0A146G3K9-F1-model_v4 DUF1475 domain-containing protein 0.9968 1 109 GO:0016020
AF-A0A2G4I9R1-F1-model_v4 DUF1475 domain-containing protein 0.9915 1 110 GO:0016020
AF-A0A2A2RBG7-F1-model_v4 DUF1475 domain-containing protein 0.991 1 108 GO:0016020
AF-A0A146G3K9-F1-model_v4 DUF1475 domain-containing protein 0.9878 1 109 GO:0016020

Feature Viewer

pLDDT pTM Quality
92.74 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map