F011823

General Info

Members Datasets Scaffolds Average Seq Length
101 75 202 164

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2687453341|2688392427
Length 201
Sequence REKTVKWGEEPKIGWVEAMYLPAVMSGVATAVRHAFSGKPMTRQYPEVEPEIPPNYRGVHRLNRDEAGRVKCVACYMCQTACPANCIEIIAAPALKDDPHWKDRDKYPATFTIDELRCIYCGMCEEACPVDAIELTSIYDLTGLSREEMVFDKEKLLSVFDKTVQSGKDPVRTHRGSLGPASEEAQTASQGPPPPGRGRHG

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
4 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
5 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
6 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
20 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
21 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
22 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
23 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
24 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
25 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
34 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
35 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
36 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
37 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
38 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
39 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
40 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
41 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
42 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
43 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
44 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
45 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
46 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
47 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
48 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
49 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
50 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
51 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
52 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
53 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
54 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
55 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
56 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
57 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
58 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
59 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
63 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
64 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
65 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
66 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
67 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
68 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
69 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
70 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
71 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
72 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
73 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
74 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
75 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 0
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.89
Rhizosphere 76.24
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_101190873 3300005336 Bacteria 659
2 Ga0070689_100174113 3300005340 Bacteria 1745
3 Ga0070688_100380623 3300005365 Bacteria 1040
4 Ga0068867_100903132 3300005459 Bacteria 795
5 Ga0070685_10225581 3300005466 Bacteria 1230
6 Ga0070679_100703785 3300005530 Bacteria 953
7 Ga0068853_100048897 3300005539 Bacteria 3633
8 Ga0068853_101081744 3300005539 Bacteria 773
9 Ga0068855_100050705 3300005563 Bacteria 4890
10 Ga0068856_100790428 3300005614 Bacteria 969
11 Ga0081539_10082863 3300005985 Bacteria 1680
12 Ga0070717_10169907 3300006028 Bacteria 1896
13 Ga0070717_10493587 3300006028 Bacteria 1106
14 Ga0068871_100827229 3300006358 Bacteria 855
15 Ga0075428_100011802 3300006844 Bacteria 9722
16 Ga0075428_100031281 3300006844 Bacteria 5885
17 Ga0075428_100472864 3300006844 Bacteria 1342
18 Ga0114129_11857799 3300009147 Bacteria 731
19 Ga0105243_10259225 3300009148 Bacteria 1556
20 Ga0105248_10251351 3300009177 Bacteria 1990
21 Ga0105249_10446420 3300009553 Bacteria 1331
22 Ga0105249_11343012 3300009553 Bacteria 787
23 Ga0157370_10169662 3300013104 Bacteria 2029
24 Ga0157378_11218536 3300013297 Bacteria 792
25 Ga0163163_11077794 3300014325 Bacteria 866
26 Ga0182008_10362809 3300014497 Bacteria 771
27 Ga0157379_11791991 3300014968 Bacteria 603
28 Ga0213876_10251923 3300021384 Bacteria 938
29 Ga0213875_10453565 3300021388 Bacteria 614
30 Ga0207671_10032359 3300025914 Bacteria 3894
31 Ga0207660_10955640 3300025917 Bacteria 699
32 Ga0207652_10626650 3300025921 Bacteria 963
33 Ga0207700_10095906 3300025928 Bacteria 2353
34 Ga0207709_10900897 3300025935 Bacteria 719
35 Ga0207639_10010028 3300026041 Bacteria 6548
36 Ga0207639_10836326 3300026041 Bacteria 859
37 Ga0207702_10831100 3300026078 Bacteria 914
38 Ga0268264_10570248 3300028381 Bacteria 1112
39 Ga0265338_10001664 3300028800 Bacteria 35394
40 Ga0265325_10001093 3300031241 Bacteria 19490
41 Ga0265340_10047475 3300031247 Bacteria 2091
42 Ga0265339_10000368 3300031249 Bacteria 35412
43 Ga0265331_10001827 3300031250 Bacteria 15080
44 Ga0265313_10000050 3300031595 Bacteria 111425
45 Ga0265314_10000306 3300031711 Bacteria 70032
46 Ga0265342_10003624 3300031712 Bacteria 12573
47 Ga0436364_0406440 3300037853 Bacteria 856
48 Ga0436365_0639462 3300039437 Bacteria 740
49 Ga0436365_0991177 3300039437 Bacteria 1403
50 Ga0436365_1004170 3300039437 Bacteria 773
51 Ga0436365_1725682 3300039437 Bacteria 1080
52 Ga0436360_0423182 3300039438 Bacteria 1070
53 Ga0436360_1312600 3300039438 Bacteria 1005
54 Ga0436360_1331216 3300039438 Bacteria 882
55 Ga0436363_0436306 3300039450 Bacteria 705
56 Ga0436363_1396100 3300039450 Bacteria 658
57 Ga0436363_1563726 3300039450 Bacteria 647
58 Ga0436362_0354282 3300039453 Bacteria 674
59 Ga0436362_1027098 3300039453 Bacteria 934
60 Ga0436362_1262530 3300039453 Bacteria 901
61 Ga0451807_0701440 3300041486 Bacteria 697
62 Ga0495608_0007165 3300046511 Bacteria 7886
63 Ga0495667_0203241 3300046559 Bacteria 1267
64 Ga0495599_0082069 3300046678 Bacteria 2014
65 Ga0495599_0328350 3300046678 Unclassified 920
66 Ga0495604_0049662 3300047317 Bacteria 3258
67 Ga0496102_0229374 3300048905 Bacteria 1751
68 Ga0496104_0402996 3300048907 Bacteria 1280
69 Ga0496104_1299659 3300048907 Bacteria 630
70 Ga0496105_0003321 3300048908 Bacteria 11882
71 Ga0496105_0548141 3300048908 Bacteria 903
72 Ga0496109_0131714 3300048912 Bacteria 2334
73 Ga0496110_0265090 3300048913 Bacteria 1564
74 Ga0496113_0081472 3300048916 Bacteria 2481
75 Ga0496113_0135176 3300048916 Bacteria 1937
76 Ga0496115_0021910 3300048918 Bacteria 4941
77 Ga0496126_0564931 3300048929 Bacteria 901
78 Ga0501034_0008747 3300049571 Bacteria 10655
79 Ga0501034_0471885 3300049571 Bacteria 1171
80 Ga0501034_0538099 3300049571 Bacteria 1078
81 Ga0501046_0716428 3300049580 Bacteria 704
82 Ga0501047_0127250 3300049581 Bacteria 2428
83 Ga0501047_0422267 3300049581 Bacteria 1165
84 Ga0501070_0262740 3300049586 Bacteria 1411
85 Ga0501071_1019637 3300049587 Bacteria 639
86 Ga0501076_0557726 3300049592 Bacteria 945
87 Ga0501080_0237393 3300049742 Bacteria 1665
88 Ga0501080_0637996 3300049742 Bacteria 943
89 Ga0501083_0768476 3300049744 Unclassified 627
90 Ga0501044_0158117 3300049823 Bacteria 2245
91 nmdc:mga09592_1132294_c1 3300050508 Bacteria 649
92 nmdc:mga06r32_398522_c1 3300050510 Bacteria 1358
93 nmdc:mga0rr50_1253867_c1 3300050513 Bacteria 629
94 Ga0495601_0000687 3300053077 Bacteria 18127
95 Ga0495601_0258007 3300053077 Bacteria 1138
96 Ga0495619_0011397 3300053085 Bacteria 5598
97 Ga0495619_0088757 3300053085 Bacteria 2091
98 Ga0495619_0154558 3300053085 Bacteria 1583
99 Ga0501084_0010693 3300054114 Bacteria 7596
100 2688392427 2687453341 Bacteria 6534136
101 2673164312 2671180531 Bacteria 9045424
102 Ga0070680_101190873
103 Ga0070689_100174113
104 Ga0070688_100380623
105 Ga0068867_100903132
106 Ga0070685_10225581
107 Ga0070679_100703785
108 Ga0068853_100048897
109 Ga0068853_101081744
110 Ga0068855_100050705
111 Ga0068856_100790428
112 Ga0081539_10082863
113 Ga0070717_10169907
114 Ga0070717_10493587
115 Ga0068871_100827229
116 Ga0075428_100011802
117 Ga0075428_100031281
118 Ga0075428_100472864
119 Ga0114129_11857799
120 Ga0105243_10259225
121 Ga0105248_10251351
122 Ga0105249_10446420
123 Ga0105249_11343012
124 Ga0157370_10169662
125 Ga0157378_11218536
126 Ga0163163_11077794
127 Ga0182008_10362809
128 Ga0157379_11791991
129 Ga0213876_10251923
130 Ga0213875_10453565
131 Ga0207671_10032359
132 Ga0207660_10955640
133 Ga0207652_10626650
134 Ga0207700_10095906
135 Ga0207709_10900897
136 Ga0207639_10010028
137 Ga0207639_10836326
138 Ga0207702_10831100
139 Ga0268264_10570248
140 Ga0265338_10001664
141 Ga0265325_10001093
142 Ga0265340_10047475
143 Ga0265339_10000368
144 Ga0265331_10001827
145 Ga0265313_10000050
146 Ga0265314_10000306
147 Ga0265342_10003624
148 Ga0436364_0406440
149 Ga0436365_0639462
150 Ga0436365_0991177
151 Ga0436365_1004170
152 Ga0436365_1725682
153 Ga0436360_0423182
154 Ga0436360_1312600
155 Ga0436360_1331216
156 Ga0436363_0436306
157 Ga0436363_1396100
158 Ga0436363_1563726
159 Ga0436362_0354282
160 Ga0436362_1027098
161 Ga0436362_1262530
162 Ga0451807_0701440
163 Ga0495608_0007165
164 Ga0495667_0203241
165 Ga0495599_0082069
166 Ga0495599_0328350
167 Ga0495604_0049662
168 Ga0496102_0229374
169 Ga0496104_0402996
170 Ga0496104_1299659
171 Ga0496105_0003321
172 Ga0496105_0548141
173 Ga0496109_0131714
174 Ga0496110_0265090
175 Ga0496113_0081472
176 Ga0496113_0135176
177 Ga0496115_0021910
178 Ga0496126_0564931
179 Ga0501034_0008747
180 Ga0501034_0471885
181 Ga0501034_0538099
182 Ga0501046_0716428
183 Ga0501047_0127250
184 Ga0501047_0422267
185 Ga0501070_0262740
186 Ga0501071_1019637
187 Ga0501076_0557726
188 Ga0501080_0237393
189 Ga0501080_0637996
190 Ga0501083_0768476
191 Ga0501044_0158117
192 nmdc:mga09592_1132294_c1
193 nmdc:mga06r32_398522_c1
194 nmdc:mga0rr50_1253867_c1
195 Ga0495601_0000687
196 Ga0495601_0258007
197 Ga0495619_0011397
198 Ga0495619_0088757
199 Ga0495619_0154558
200 Ga0501084_0010693
201 2688392427
202 2673164312

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

111

134

0.95

PF13187

Fer4_9

4Fe-4S dicluster domain

71

133

0.93

PF12838

Fer4_7

4Fe-4S dicluster domain

71

132

0.76

Map