F011435

General Info

Members Datasets Scaffolds Average Seq Length
101 83 202 249

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0214598|Ga0501074_0214598_259_1113
Length 284
Sequence MAPDFGDLDEVPALSPPRDPTPTSGTDGDVQGAAMGDKSAIEWTEATWNPSTGCDKTSPGCDNCYALTLSKRLKAMGQAKYQNDGDPRTSGPGFGLTIHPDTLDIPRAWTAPRTIFVNSMSDLFHKDVPVSYIRQVFQVMADTPQHTYQVLTKRSKRLADVGQHLDWPPNVWMGVSVENTKYRFRLAHLRQVDAAVRFVSAEPLLGPLEDLDLDGIHWLIAGGESGPRARPMDPEWVVDLKNQCFDAGVPFFFKQWGGRTPKAGGRELEGFTYDEMPERILTIA

Samples

Sample ID Description Type Environment
1 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
29 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
49 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
52 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
53 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
54 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
58 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
59 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
60 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
61 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
65 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
66 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
67 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
68 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
69 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
73 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
74 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
75 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
78 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
79 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
80 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
81 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
82 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
83 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 0
Rhizosphere 95.05
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501074_0214598 3300049590 Bacteria 1370
2 rootL2_10150533 3300003322 Bacteria 2636
3 Ga0070674_100437037 3300005356 Bacteria 1077
4 Ga0070659_100031007 3300005366 Bacteria 4139
5 Ga0070663_100167413 3300005455 Bacteria 1696
6 Ga0070681_10321726 3300005458 Bacteria 1456
7 Ga0070706_100039233 3300005467 Bacteria 4371
8 Ga0070698_100142451 3300005471 Bacteria 2348
9 Ga0068853_100474829 3300005539 Bacteria 1178
10 Ga0070672_100124066 3300005543 Bacteria 2117
11 Ga0068855_100075840 3300005563 Bacteria 3904
12 Ga0068852_100482747 3300005616 Bacteria 1232
13 Ga0068860_100069367 3300005843 Bacteria 3350
14 Ga0068862_100004069 3300005844 Bacteria 12400
15 Ga0068862_100250650 3300005844 Bacteria 1613
16 Ga0081539_10083148 3300005985 Viruses 1676
17 Ga0070717_10116874 3300006028 Bacteria 2281
18 Ga0075428_100109090 3300006844 Bacteria 3016
19 Ga0075430_100063055 3300006846 Bacteria 3114
20 Ga0068865_100130478 3300006881 Bacteria 1882
21 Ga0105250_10000169 3300009092 Bacteria 56738
22 Ga0114129_10253220 3300009147 Bacteria 2363
23 Ga0105249_10000261 3300009553 Bacteria 56552
24 Ga0105249_10049073 3300009553 Bacteria 3849
25 Ga0105249_10216889 3300009553 Bacteria 1881
26 Ga0105239_11116557 3300010375 Bacteria 908
27 Ga0105246_10088848 3300011119 Bacteria 2222
28 Ga0157374_10487516 3300013296 Bacteria 1236
29 Ga0157378_10000937 3300013297 Bacteria 26852
30 Ga0163162_10119544 3300013306 Bacteria 2738
31 Ga0213873_10045803 3300021358 Unclassified 1142
32 Ga0207696_1000302 3300025711 Bacteria 56609
33 Ga0207705_10093291 3300025909 Bacteria 2207
34 Ga0207684_10086265 3300025910 Unclassified 2674
35 Ga0207695_10009892 3300025913 Bacteria 11718
36 Ga0207687_10683489 3300025927 Bacteria 870
37 Ga0207690_10042409 3300025932 Bacteria 2988
38 Ga0207709_10094283 3300025935 Bacteria 1964
39 Ga0207704_10074524 3300025938 Bacteria 2166
40 Ga0207691_10019251 3300025940 Bacteria 6462
41 Ga0207711_10000020 3300025941 Bacteria 363325
42 Ga0207667_10335377 3300025949 Bacteria 1544
43 Ga0207712_10000219 3300025961 Bacteria 56743
44 Ga0207712_10091387 3300025961 Bacteria 2242
45 Ga0207712_10127295 3300025961 Bacteria 1935
46 Ga0207668_10208329 3300025972 Bacteria 1562
47 Ga0207639_10446380 3300026041 Bacteria 1173
48 Ga0207678_10177478 3300026067 Bacteria 1819
49 Ga0207702_10003166 3300026078 Bacteria 15221
50 Ga0268265_10000869 3300028380 Bacteria 28333
51 Ga0268265_10662605 3300028380 Bacteria 1004
52 Ga0268264_10025501 3300028381 Bacteria 4830
53 Ga0265318_10077200 3300028577 Bacteria 1232
54 Ga0265322_10028419 3300028654 Bacteria 1598
55 Ga0307515_10038809 3300028794 Bacteria 7601
56 Ga0265338_10010720 3300028800 Bacteria 10700
57 Ga0265338_10012092 3300028800 Bacteria 9866
58 Ga0265338_10081262 3300028800 Bacteria 2719
59 Ga0265324_10051875 3300029957 Unclassified 1409
60 Ga0265330_10005136 3300031235 Bacteria 6555
61 Ga0265329_10003608 3300031242 Bacteria 6683
62 Ga0265340_10047002 3300031247 Bacteria 2104
63 Ga0265316_10000270 3300031344 Bacteria 58447
64 Ga0265314_10000046 3300031711 Bacteria 199789
65 Ga0316576_10001167 3300031727 Bacteria 13778
66 Ga0316576_10478060 3300031727 Bacteria 918
67 Ga0316577_10398782 3300031733 Bacteria 781
68 Ga0373937_0485448 3300036401 Bacteria 1174
69 Ga0436362_0046697 3300039453 Bacteria 3866
70 Ga0453683_0000682 3300044673 Bacteria 35947
71 Ga0453684_0000164 3300044712 Bacteria 296093
72 Ga0453684_0000269 3300044712 Bacteria 223826
73 Ga0453684_0064370 3300044712 Bacteria 4684
74 Ga0453684_0122270 3300044712 Bacteria 3141
75 Ga0453684_0538210 3300044712 Bacteria 1288
76 Ga0451576_0002710 3300045051 Bacteria 25737
77 Ga0451576_0044424 3300045051 Bacteria 4683
78 Ga0451576_0692449 3300045051 Bacteria 1071
79 Ga0495622_0000319 3300046557 Bacteria 35466
80 Ga0495667_0043096 3300046559 Bacteria 2991
81 Ga0495667_0285586 3300046559 Bacteria 1047
82 Ga0495600_0029284 3300046809 Bacteria 3565
83 Ga0495604_0000058 3300047317 Bacteria 96955
84 Ga0496125_0070156 3300048928 Bacteria 2745
85 Ga0501036_0180824 3300049572 Bacteria 1775
86 Ga0501037_0075586 3300049573 Bacteria 2446
87 Ga0501047_0471022 3300049581 Bacteria 1084
88 Ga0501073_0022959 3300049589 Bacteria 4486
89 Ga0501073_0325315 3300049589 Bacteria 1061
90 Ga0501080_0000608 3300049742 Bacteria 28340
91 Ga0501083_0240615 3300049744 Bacteria 1178
92 Ga0501035_0110345 3300049822 Bacteria 2411
93 Ga0501044_0009083 3300049823 Bacteria 10858
94 Ga0501044_0239163 3300049823 Bacteria 1760
95 Ga0501045_0000746 3300049824 Bacteria 20798
96 nmdc:mga05p37_180164_c1 3300050507 Bacteria 2571
97 nmdc:mga0a205_441817_c1 3300050515 Bacteria 1161
98 Ga0495612_0022641 3300053078 Bacteria 2517
99 Ga0500556_0041692 3300053104 Bacteria 1620
100 Ga0500616_0002926 3300053153 Bacteria 13608
101 Ga0501084_0703997 3300054114 Bacteria 852
102 Ga0501074_0214598
103 rootL2_10150533
104 Ga0070674_100437037
105 Ga0070659_100031007
106 Ga0070663_100167413
107 Ga0070681_10321726
108 Ga0070706_100039233
109 Ga0070698_100142451
110 Ga0068853_100474829
111 Ga0070672_100124066
112 Ga0068855_100075840
113 Ga0068852_100482747
114 Ga0068860_100069367
115 Ga0068862_100004069
116 Ga0068862_100250650
117 Ga0081539_10083148
118 Ga0070717_10116874
119 Ga0075428_100109090
120 Ga0075430_100063055
121 Ga0068865_100130478
122 Ga0105250_10000169
123 Ga0114129_10253220
124 Ga0105249_10000261
125 Ga0105249_10049073
126 Ga0105249_10216889
127 Ga0105239_11116557
128 Ga0105246_10088848
129 Ga0157374_10487516
130 Ga0157378_10000937
131 Ga0163162_10119544
132 Ga0213873_10045803
133 Ga0207696_1000302
134 Ga0207705_10093291
135 Ga0207684_10086265
136 Ga0207695_10009892
137 Ga0207687_10683489
138 Ga0207690_10042409
139 Ga0207709_10094283
140 Ga0207704_10074524
141 Ga0207691_10019251
142 Ga0207711_10000020
143 Ga0207667_10335377
144 Ga0207712_10000219
145 Ga0207712_10091387
146 Ga0207712_10127295
147 Ga0207668_10208329
148 Ga0207639_10446380
149 Ga0207678_10177478
150 Ga0207702_10003166
151 Ga0268265_10000869
152 Ga0268265_10662605
153 Ga0268264_10025501
154 Ga0265318_10077200
155 Ga0265322_10028419
156 Ga0307515_10038809
157 Ga0265338_10010720
158 Ga0265338_10012092
159 Ga0265338_10081262
160 Ga0265324_10051875
161 Ga0265330_10005136
162 Ga0265329_10003608
163 Ga0265340_10047002
164 Ga0265316_10000270
165 Ga0265314_10000046
166 Ga0316576_10001167
167 Ga0316576_10478060
168 Ga0316577_10398782
169 Ga0373937_0485448
170 Ga0436362_0046697
171 Ga0453683_0000682
172 Ga0453684_0000164
173 Ga0453684_0000269
174 Ga0453684_0064370
175 Ga0453684_0122270
176 Ga0453684_0538210
177 Ga0451576_0002710
178 Ga0451576_0044424
179 Ga0451576_0692449
180 Ga0495622_0000319
181 Ga0495667_0043096
182 Ga0495667_0285586
183 Ga0495600_0029284
184 Ga0495604_0000058
185 Ga0496125_0070156
186 Ga0501036_0180824
187 Ga0501037_0075586
188 Ga0501047_0471022
189 Ga0501073_0022959
190 Ga0501073_0325315
191 Ga0501080_0000608
192 Ga0501083_0240615
193 Ga0501035_0110345
194 Ga0501044_0009083
195 Ga0501044_0239163
196 Ga0501045_0000746
197 nmdc:mga05p37_180164_c1
198 nmdc:mga0a205_441817_c1
199 Ga0495612_0022641
200 Ga0500556_0041692
201 Ga0500616_0002926
202 Ga0501084_0703997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07505

DUF5131

Protein of unknown function (DUF5131)

38

277

0.97

PF17338

GP88

Gene product 88

29

248

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qp1-assembly1.cif.gz_A crystal structure of the plp-bound c-s lyase in the external aldimine form from staphylococcus hominis complexed with an inhibitor, l-cycloserine. 0.6824 201 239
6qp1-assembly1.cif.gz_B crystal structure of the plp-bound c-s lyase in the external aldimine form from staphylococcus hominis complexed with an inhibitor, l-cycloserine. 0.6799 201 239
5g2q-assembly1.cif.gz_G the crystal structure of a s-selective transaminase from arthrobacter sp. with alanine bound 0.6778 194 239
5g2p-assembly1.cif.gz_C the crystal structure of a s-selective transaminase from arthrobacter sp. 0.6744 194 239
5g2p-assembly1.cif.gz_A the crystal structure of a s-selective transaminase from arthrobacter sp. 0.6739 194 239
ID Description Score Start End Superfamily
af_I6YA42_4_243_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9928 25 263 3.20.20.70
af_I6YA42_4_243_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9846 25 263 3.20.20.70
1o4sB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.6991 194 239 3.40.640.10
3b46A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.6747 195 239 3.40.640.10
5g2pC02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.6744 194 239 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A3D5DSP4-F1-model_v4 DUF5131 family protein 0.9954 155 263
AF-A0A117IHW4-F1-model_v4 deleted 0.995 107 265
AF-A0A0Y1CXX1-F1-model_v4 deleted 0.9949 33 263
AF-A0A1E3X2J7-F1-model_v4 Putative phage protein 0.9934 32 185
AF-A0A7V3MBX2-F1-model_v4 DUF5131 family protein 0.9928 83 229

Map