F010558

General Info

Members Datasets Scaffolds Average Seq Length
101 40 97 119

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0802372|Ga0466963_0802372_31_462
Length 143
Sequence MKRPVPFVRTAGMATAFGNGDEYMANTIMTVDDSSSVRQVVAFTLRSAGYDVIEAVDGSDAITKLSGPVKMVITDLNMPRMDGIELIRAIRRTTAYRAIPIVMLTTESQDAKKQAGKAAGATGWIVKPFRPEQLLAVVKKVLG

Samples

Sample ID Description Type Environment
1 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
2 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
3 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
6 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
7 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
8 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
9 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
10 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
11 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
12 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
13 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
14 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
15 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
16 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
17 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
18 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
19 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
20 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
22 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
23 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
24 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
25 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
26 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
27 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
28 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
29 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
30 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
31 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
32 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
33 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
34 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
35 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
36 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
37 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
38 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
39 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
40 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.05
Metatranscriptomes 0.99
Isolates 3.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.98
Rhizosphere 82.18
Stem 0
Stem Tuber 0
Unclassified 15.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10302665 3300003320 Bacteria 2586
2 Ga0070717_10600629 3300006028 Bacteria 998
3 Ga0105248_11354142 3300009177 Bacteria 805
4 Ga0157374_11232253 3300013296 Bacteria 770
5 Ga0157378_11185609 3300013297 Unclassified 803
6 Ga0163163_10394058 3300014325 Bacteria 1443
7 Ga0157380_12813645 3300014326 Unclassified 553
8 Ga0213874_10138652 3300021377 Bacteria 841
9 Ga0265338_10235271 3300028800 Unclassified 1360
10 Ga0265324_10006433 3300029957 Bacteria 4899
11 Ga0265324_10041556 3300029957 Bacteria 1590
12 Ga0265327_10005707 3300031251 Bacteria 10271
13 Ga0265327_10013838 3300031251 Bacteria 5328
14 Ga0265327_10046875 3300031251 Bacteria 2284
15 Ga0265316_10621154 3300031344 Bacteria 765
16 Ga0307509_10282847 3300031507 Bacteria 1419
17 Ga0316575_10118282 3300031665 Bacteria 1083
18 Ga0316575_10307877 3300031665 Bacteria 671
19 Ga0316575_10336900 3300031665 Bacteria 641
20 Ga0265342_10663933 3300031712 Bacteria 523
21 Ga0316576_10122091 3300031727 Bacteria 1957
22 Ga0316588_1173139 3300033528 Bacteria 559
23 Ga0316574_0243708 3300035398 Bacteria 1149
24 Ga0316574_0253428 3300035398 Bacteria 1124
25 Ga0373927_0740353 3300035695 Bacteria 649
26 Ga0400483_012139 3300039062 Bacteria 6134
27 Ga0400483_069180 3300039062 Bacteria 2078
28 Ga0400483_082684 3300039062 Bacteria 2468
29 Ga0400483_195554 3300039062 Bacteria 1031
30 Ga0400483_292099 3300039062 Bacteria 3145
31 Ga0400487_58475 3300039110 Unclassified 1125
32 Ga0436365_1657275 3300039437 Bacteria 9984
33 Ga0436363_1253979 3300039450 Bacteria 1432
34 Ga0451789_0590639 3300041443 Bacteria 539
35 Ga0451853_3143266 3300041512 Bacteria 737
36 Ga0451577_0022606 3300042876 Bacteria 5742
37 Ga0451577_0030717 3300042876 Bacteria 4852
38 Ga0451577_0068728 3300042876 Bacteria 3159
39 Ga0451577_0140836 3300042876 Bacteria 2167
40 Ga0451577_0252798 3300042876 Bacteria 1595
41 Ga0451577_0378258 3300042876 Bacteria 1285
42 Ga0451577_0382840 3300042876 Bacteria 1277
43 Ga0451577_1203176 3300042876 Bacteria 676
44 Ga0466972_0107583 3300044658 Bacteria 1318
45 Ga0453683_0000462 3300044673 Bacteria 46608
46 Ga0453683_0009347 3300044673 Bacteria 6550
47 Ga0453683_0037461 3300044673 Bacteria 3051
48 Ga0453683_0077046 3300044673 Bacteria 2088
49 Ga0453683_0562109 3300044673 Bacteria 743
50 Ga0453683_1006199 3300044673 Unclassified 553
51 Ga0466963_0080298 3300044694 Unclassified 2208
52 Ga0466963_0802372 3300044694 Unclassified 664
53 Ga0453684_0000436 3300044712 Bacteria 170125
54 Ga0453684_0003655 3300044712 Bacteria 34156
55 Ga0453684_0006198 3300044712 Bacteria 22939
56 Ga0453684_0007747 3300044712 Bacteria 19594
57 Ga0453684_0010147 3300044712 Bacteria 16171
58 Ga0453684_0010443 3300044712 Bacteria 15879
59 Ga0453684_0012182 3300044712 Bacteria 14259
60 Ga0453684_0013663 3300044712 Bacteria 13153
61 Ga0453684_0014508 3300044712 Bacteria 12584
62 Ga0453684_0015365 3300044712 Bacteria 12122
63 Ga0453684_0016524 3300044712 Bacteria 11525
64 Ga0453684_0020263 3300044712 Bacteria 10049
65 Ga0453684_0023473 3300044712 Bacteria 9077
66 Ga0453684_0042458 3300044712 Bacteria 6130
67 Ga0453684_0045455 3300044712 Bacteria 5858
68 Ga0453684_0136001 3300044712 Unclassified 2943
69 Ga0453684_0140019 3300044712 Bacteria 2891
70 Ga0453684_0171508 3300044712 Bacteria 2556
71 Ga0453684_0195338 3300044712 Bacteria 2364
72 Ga0453684_0195930 3300044712 Bacteria 2359
73 Ga0453684_0196501 3300044712 Bacteria 2355
74 Ga0453684_0303272 3300044712 Bacteria 1815
75 Ga0453684_0308157 3300044712 Bacteria 1798
76 Ga0453684_0408075 3300044712 Bacteria 1520
77 Ga0453684_0483396 3300044712 Bacteria 1373
78 Ga0453684_0621021 3300044712 Bacteria 1182
79 Ga0453684_0824009 3300044712 Bacteria 999
80 Ga0453684_0866749 3300044712 Bacteria 969
81 Ga0453684_1429175 3300044712 Bacteria 716
82 Ga0453684_1875302 3300044712 Bacteria 607
83 Ga0453684_2068734 3300044712 Bacteria 572
84 Ga0453684_2163479 3300044712 Bacteria 556
85 Ga0453684_2275899 3300044712 Bacteria 539
86 Ga0466968_0150223 3300044735 Bacteria 1070
87 Ga0451576_0000319 3300045051 Bacteria 116651
88 Ga0451576_0000818 3300045051 Bacteria 60737
89 Ga0451576_0029331 3300045051 Bacteria 5888
90 Ga0451576_0451390 3300045051 Bacteria 1350
91 Ga0451576_1922635 3300045051 Bacteria 610
92 Ga0451576_2662632 3300045051 Bacteria 509
93 Ga0466958_0752251 3300045836 Unclassified 635
94 Ga0495582_0567015 3300046473 Bacteria 657
95 Ga0495674_0488553 3300047319 Bacteria 986
96 Ga0496113_1459866 3300048916 Bacteria 529
97 Ga0501077_0496296 3300049593 Bacteria 783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031665 Ga0316575_10336900 Ga0316575_103369002 105
2 3300042876 Ga0451577_1203176 Ga0451577_1203176_17_334 105
3 3300044712 Ga0453684_0483396 Ga0453684_0483396_1030_1347 105
4 3300044735 Ga0466968_0150223 Ga0466968_0150223_709_1026 105
5 3300039437 Ga0436365_1657275 Ga0436365_1657275_5358_5684 108
6 3300039450 Ga0436363_1253979 Ga0436363_1253979_343_669 108
7 3300041443 Ga0451789_0590639 Ga0451789_0590639_151_477 108
8 3300041512 Ga0451853_3143266 Ga0451853_3143266_294_620 108
9 3300035398 Ga0316574_0243708 Ga0316574_0243708_416_787 113
10 3300044658 Ga0466972_0107583 Ga0466972_0107583_812_1156 114
11 3300014326 Ga0157380_12813645 Ga0157380_128136452 116
12 3300039062 Ga0400483_012139 Ga0400483_012139_693_1043 116
13 3300039062 Ga0400483_292099 Ga0400483_292099_2024_2374 116
14 3300044673 Ga0453683_0009347 Ga0453683_0009347_1406_1756 116
15 3300044673 Ga0453683_0037461 Ga0453683_0037461_14_364 116
16 3300044673 Ga0453683_1006199 Ga0453683_1006199_35_385 116
17 3300044712 Ga0453684_0195338 Ga0453684_0195338_1143_1493 116
18 3300049593 Ga0501077_0496296 Ga0501077_0496296_191_541 116
19 iso_pu_bacteria 2887630918 2887633892 116
20 iso_pu_bacteria 2740891818 2740991756 117
21 iso_pu_bacteria 2740891818 2740992320 117
22 iso_pu_bacteria 2786546940 2788435165 117
23 3300044712 Ga0453684_0003655 Ga0453684_0003655_8407_8766 119
24 3300006028 Ga0070717_10600629 Ga0070717_106006292 120
25 3300009177 Ga0105248_11354142 Ga0105248_113541422 120
26 3300013296 Ga0157374_11232253 Ga0157374_112322532 120
27 3300013297 Ga0157378_11185609 Ga0157378_111856092 120
28 3300014325 Ga0163163_10394058 Ga0163163_103940581 120
29 3300021377 Ga0213874_10138652 Ga0213874_101386522 120
30 3300035695 Ga0373927_0740353 Ga0373927_0740353_124_486 120
31 3300044694 Ga0466963_0080298 Ga0466963_0080298_411_773 120
32 3300044694 Ga0466963_0802372 Ga0466963_0802372_31_462 120
33 3300045051 Ga0451576_0451390 Ga0451576_0451390_725_1093 120
34 3300045836 Ga0466958_0752251 Ga0466958_0752251_59_421 120
35 3300046473 Ga0495582_0567015 Ga0495582_0567015_133_495 120
36 3300047319 Ga0495674_0488553 Ga0495674_0488553_477_839 120
37 3300048916 Ga0496113_1459866 Ga0496113_1459866_26_388 120
38 3300003320 rootH2_10302665 rootH2_103026652 121
39 3300028800 Ga0265338_10235271 Ga0265338_102352712 121
40 3300029957 Ga0265324_10006433 Ga0265324_100064332 121
41 3300029957 Ga0265324_10041556 Ga0265324_100415562 121
42 3300031251 Ga0265327_10005707 Ga0265327_100057075 121
43 3300031251 Ga0265327_10013838 Ga0265327_100138383 121
44 3300031251 Ga0265327_10046875 Ga0265327_100468754 121
45 3300031344 Ga0265316_10621154 Ga0265316_106211542 121
46 3300031507 Ga0307509_10282847 Ga0307509_102828472 121
47 3300031665 Ga0316575_10118282 Ga0316575_101182821 121
48 3300031665 Ga0316575_10307877 Ga0316575_103078772 121
49 3300031712 Ga0265342_10663933 Ga0265342_106639332 121
50 3300031727 Ga0316576_10122091 Ga0316576_101220912 121
51 3300033528 Ga0316588_1173139 Ga0316588_11731392 121
52 3300035398 Ga0316574_0253428 Ga0316574_0253428_163_531 121
53 3300039062 Ga0400483_069180 Ga0400483_069180_333_698 121
54 3300039062 Ga0400483_082684 Ga0400483_082684_526_891 121
55 3300039062 Ga0400483_195554 Ga0400483_195554_353_718 121
56 3300039110 Ga0400487_58475 Ga0400487_58475_293_658 121
57 3300042876 Ga0451577_0022606 Ga0451577_0022606_4450_4818 121
58 3300042876 Ga0451577_0030717 Ga0451577_0030717_19_384 121
59 3300042876 Ga0451577_0068728 Ga0451577_0068728_1640_2005 121
60 3300042876 Ga0451577_0140836 Ga0451577_0140836_309_674 121
61 3300042876 Ga0451577_0252798 Ga0451577_0252798_826_1191 121
62 3300042876 Ga0451577_0378258 Ga0451577_0378258_780_1145 121
63 3300042876 Ga0451577_0382840 Ga0451577_0382840_34_399 121
64 3300044673 Ga0453683_0000462 Ga0453683_0000462_28269_28634 121
65 3300044673 Ga0453683_0077046 Ga0453683_0077046_123_488 121
66 3300044673 Ga0453683_0562109 Ga0453683_0562109_48_413 121
67 3300044712 Ga0453684_0000436 Ga0453684_0000436_70644_71009 121
68 3300044712 Ga0453684_0006198 Ga0453684_0006198_5516_5881 121
69 3300044712 Ga0453684_0007747 Ga0453684_0007747_15910_16275 121
70 3300044712 Ga0453684_0010147 Ga0453684_0010147_658_1023 121
71 3300044712 Ga0453684_0010443 Ga0453684_0010443_7583_7948 121
72 3300044712 Ga0453684_0012182 Ga0453684_0012182_3150_3515 121
73 3300044712 Ga0453684_0013663 Ga0453684_0013663_10948_11313 121
74 3300044712 Ga0453684_0014508 Ga0453684_0014508_10810_11178 121
75 3300044712 Ga0453684_0015365 Ga0453684_0015365_8085_8450 121
76 3300044712 Ga0453684_0016524 Ga0453684_0016524_8354_8719 121
77 3300044712 Ga0453684_0020263 Ga0453684_0020263_6230_6595 121
78 3300044712 Ga0453684_0023473 Ga0453684_0023473_3956_4321 121
79 3300044712 Ga0453684_0042458 Ga0453684_0042458_3916_4281 121
80 3300044712 Ga0453684_0045455 Ga0453684_0045455_264_632 121
81 3300044712 Ga0453684_0136001 Ga0453684_0136001_71_436 121
82 3300044712 Ga0453684_0140019 Ga0453684_0140019_250_615 121
83 3300044712 Ga0453684_0171508 Ga0453684_0171508_1181_1564 121
84 3300044712 Ga0453684_0195930 Ga0453684_0195930_1818_2186 121
85 3300044712 Ga0453684_0196501 Ga0453684_0196501_626_991 121
86 3300044712 Ga0453684_0303272 Ga0453684_0303272_869_1234 121
87 3300044712 Ga0453684_0308157 Ga0453684_0308157_268_633 121
88 3300044712 Ga0453684_0408075 Ga0453684_0408075_162_527 121
89 3300044712 Ga0453684_0621021 Ga0453684_0621021_88_453 121
90 3300044712 Ga0453684_0824009 Ga0453684_0824009_543_908 121
91 3300044712 Ga0453684_0866749 Ga0453684_0866749_47_412 121
92 3300044712 Ga0453684_1429175 Ga0453684_1429175_119_484 121
93 3300044712 Ga0453684_1875302 Ga0453684_1875302_105_470 121
94 3300044712 Ga0453684_2068734 Ga0453684_2068734_94_459 121
95 3300044712 Ga0453684_2163479 Ga0453684_2163479_121_486 121
96 3300044712 Ga0453684_2275899 Ga0453684_2275899_161_526 121
97 3300045051 Ga0451576_0000319 Ga0451576_0000319_54918_55283 121
98 3300045051 Ga0451576_0000818 Ga0451576_0000818_22371_22739 121
99 3300045051 Ga0451576_0029331 Ga0451576_0029331_3440_3805 121
100 3300045051 Ga0451576_1922635 Ga0451576_1922635_13_384 121
101 3300045051 Ga0451576_2662632 Ga0451576_2662632_67_432 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

28

139

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9788 2 121
4h60-assembly1.cif.gz_A high resolution structure of vibrio cholerae chemotaxis protein chey4 crystallized in low ph (4.0) condition 0.9751 1 120
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9712 3 120
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9709 2 121
6rfv-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 ph 7 0.9697 2 121
ID Description Score Start End Superfamily
af_I1NCE1_621_722_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9791 2 70 3.40.50.2300
4ja2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9715 2 120 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9679 1 120 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9677 3 81 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9674 2 120 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3D8PEB8-F1-model_v4 Response regulatory domain-containing protein 0.9953 1 119 GO:0000160
AF-A7BZ01-F1-model_v4 deleted 0.9939 2 121
AF-A0A5K7YQZ7-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9939 2 119 GO:0000155
AF-A0A7Y0C1S4-F1-model_v4 Response regulator 0.9937 2 119 GO:0000160
AF-I1XL96-F1-model_v4 Chemotaxis regulator 0.9928 3 121 GO:0000160

Feature Viewer

pLDDT pTM Quality
93.33 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map