F009048

General Info

Members Datasets Scaffolds Average Seq Length
101 86 93 187

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10000494|Ga0163162_1000049425
Length 203
Sequence MSGKAFAEKSIVTKSGRMKRQYKKEDFPLSKIRRYLEPGPIVLVSSCWNGKNNIMTMGWHTMMEFSPSMIGCFITNANHSYEMIRRSGECVINIPTADMIDKVIGIGNSHGTKMDKFKKFGLTAEVAKIVNAPVIRECYANFECKIKDKHLLPKYNFFILEVVAARVATLPKYPKTVHYTGDGVFMVSGKHIAFPQKFKRQNL

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
3 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
4 2904456579 Variovorax sp. 2002 Isolate Unclassified
5 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
6 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
7 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
8 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
32 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
42 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
43 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
46 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
47 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
50 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
51 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
52 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
53 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
54 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
57 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
58 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
59 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
60 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
61 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
62 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
63 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
64 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
65 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
71 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
72 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
73 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
74 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
75 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
76 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
77 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
78 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
79 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
80 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
81 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
82 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
83 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
84 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
85 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
86 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.1
Metatranscriptomes 1.98
Isolates 7.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.77
Nodule 0
Rhizoplane 0
Rhizosphere 53.47
Stem 0
Stem Tuber 0
Unclassified 23.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10030579 3300001989 Bacteria 1866
2 rootH2_10219864 3300003320 Bacteria 3723
3 rootL2_10076161 3300003322 Bacteria 5419
4 rootL2_10233856 3300003322 Unclassified 3477
5 rootH1_10018935 3300003323 Unclassified 2311
6 rootH1_10187705 3300003323 Bacteria 2369
7 rootH1_10258013 3300003323 Bacteria 2361
8 rootH1_10325856 3300003323 Unclassified 1210
9 rootH1_10338715 3300003323 Bacteria 1424
10 rootH1_10398385 3300003323 Bacteria 1100
11 Ga0006562J51391_1089446 3300003578 Bacteria 6060
12 Ga0006562J51391_1089447 3300003578 Bacteria 4110
13 Ga0055540_1001036 3300003792 Bacteria 17799
14 Ga0055531_10000014 3300003794 Bacteria 184532
15 Ga0065714_10123239 3300005288 Bacteria 1324
16 Ga0065704_10113975 3300005289 Bacteria 1901
17 Ga0070694_100282516 3300005444 Bacteria 1266
18 Ga0070665_100010545 3300005548 Bacteria 9353
19 Ga0068854_100314266 3300005578 Bacteria 1271
20 Ga0075368_10024897 3300006042 Bacteria 2294
21 Ga0075362_10047027 3300006177 Bacteria 1921
22 Ga0075366_10050196 3300006195 Bacteria 2477
23 Ga0075370_10006535 3300006353 Bacteria 5871
24 Ga0075370_10045726 3300006353 Bacteria 2476
25 Ga0075370_10242233 3300006353 Bacteria 1068
26 Ga0075431_100676717 3300006847 Bacteria 1011
27 Ga0105249_11209680 3300009553 Unclassified 827
28 Ga0157373_10127806 3300013100 Bacteria 1787
29 Ga0157370_10346820 3300013104 Bacteria 1368
30 Ga0157370_11028914 3300013104 Unclassified 745
31 Ga0157378_10081855 3300013297 Bacteria 2918
32 Ga0163162_10000494 3300013306 Bacteria 36629
33 Ga0182005_1000146 3300015265 Bacteria 49460
34 Ga0209050_1000452 3300025298 Bacteria 73748
35 Ga0209051_1000128 3300025303 Bacteria 142159
36 Ga0209257_1000004 3300025304 Bacteria 1678347
37 Ga0207680_10048272 3300025903 Bacteria 2528
38 Ga0207658_10338982 3300025986 Bacteria 1306
39 Ga0207674_10036039 3300026116 Bacteria 5160
40 Ga0268266_10006885 3300028379 Bacteria 10350
41 Ga0265318_10098621 3300028577 Unclassified 1075
42 Ga0307515_10000681 3300028794 Bacteria 78150
43 Ga0265320_10106708 3300031240 Unclassified 1286
44 Ga0265331_10111556 3300031250 Unclassified 1254
45 Ga0307513_10061371 3300031456 Bacteria 3981
46 Ga0307513_10205497 3300031456 Bacteria 1806
47 Ga0307408_100541790 3300031548 Bacteria 1025
48 Ga0307508_10046987 3300031616 Bacteria 3853
49 Ga0307514_10003247 3300031649 Bacteria 15881
50 Ga0307514_10098970 3300031649 Bacteria 2100
51 Ga0265342_10277762 3300031712 Unclassified 887
52 Ga0307406_10000605 3300031901 Bacteria 20510
53 Ga0373943_0027079 3300035170 Bacteria 2691
54 Ga0395900_0670677 3300037418 Bacteria 972
55 Ga0439431_0036995 3300041997 Bacteria 1231
56 Ga0439457_041547 3300042014 Bacteria 1025
57 Ga0466972_0000002 3300044658 Bacteria 408005
58 Ga0466968_0082457 3300044735 Bacteria 1415
59 Ga0466970_0000342 3300044765 Bacteria 22641
60 Ga0495638_0000013 3300046460 Bacteria 430133
61 Ga0495656_0000001 3300046615 Bacteria 410042
62 Ga0495668_0001289 3300046616 Bacteria 24742
63 Ga0495659_0004651 3300046664 Bacteria 4322
64 Ga0495672_0076450 3300047320 Bacteria 1880
65 Ga0495672_0108393 3300047320 Bacteria 1494
66 Ga0495672_0333221 3300047320 Bacteria 709
67 Ga0495686_0040453 3300047472 Bacteria 2972
68 Ga0496123_0131906 3300048926 Bacteria 1382
69 Ga0496125_0210038 3300048928 Bacteria 1265
70 Ga0496126_0008638 3300048929 Bacteria 10952
71 Ga0501032_0401309 3300049569 Bacteria 881
72 Ga0501034_0000770 3300049571 Bacteria 47944
73 Ga0501034_0338678 3300049571 Bacteria 1434
74 Ga0501037_0433976 3300049573 Bacteria 898
75 Ga0501038_0162080 3300049574 Bacteria 1816
76 Ga0501047_0387315 3300049581 Bacteria 1232
77 Ga0501068_0181072 3300049584 Bacteria 1332
78 Ga0501073_0073321 3300049589 Bacteria 2384
79 Ga0501074_0089803 3300049590 Bacteria 2200
80 Ga0501083_0003414 3300049744 Bacteria 11106
81 Ga0501241_000087 3300049758 Bacteria 20114
82 nmdc:mga03683_40008_c1 3300050489 Bacteria 1921
83 nmdc:mga0yw44_102421_c2 3300050492 Bacteria 1107
84 nmdc:mga07m45_40453_c1 3300050496 Bacteria 2608
85 Ga0500646_0051821 3300053090 Bacteria 1186
86 Ga0500583_0002138 3300053092 Bacteria 5861
87 Ga0500557_006455 3300053105 Bacteria 2660
88 Ga0500592_011371 3300053116 Bacteria 1423
89 Ga0500621_269476 3300053126 Bacteria 561
90 Ga0500642_0284620 3300053130 Unclassified 750
91 Ga0500616_0000013 3300053153 Bacteria 674172
92 Ga0500624_003238 3300053157 Bacteria 2143
93 Ga0500661_005836 3300055283 Bacteria 2294

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053126 Ga0500621_269476 Ga0500621_269476_23_550 175
2 3300048926 Ga0496123_0131906 Ga0496123_0131906_354_914 179
3 iso_pu_bacteria 3007315729 3007319657 181
4 iso_pu_bacteria 2818991442 2819573868 182
5 iso_pu_bacteria 2896109856 2896112247 182
6 iso_pu_bacteria 2929177148 2929182053 182
7 iso_pu_bacteria 2945977869 2945977995 182
8 iso_pu_bacteria 2946013367 2946016153 182
9 iso_pu_bacteria 2904449895 2904453837 184
10 iso_pu_bacteria 2904456579 2904462312 184
11 3300003322 rootL2_10233856 rootL2_102338562 185
12 3300003323 rootH1_10258013 rootH1_102580132 185
13 3300003323 rootH1_10398385 rootH1_103983851 185
14 3300005444 Ga0070694_100282516 Ga0070694_1002825161 185
15 3300006042 Ga0075368_10024897 Ga0075368_100248973 185
16 3300006353 Ga0075370_10006535 Ga0075370_100065352 185
17 3300028577 Ga0265318_10098621 Ga0265318_100986212 185
18 3300031240 Ga0265320_10106708 Ga0265320_101067082 185
19 3300031250 Ga0265331_10111556 Ga0265331_101115562 185
20 3300031712 Ga0265342_10277762 Ga0265342_102777622 185
21 3300037418 Ga0395900_0670677 Ga0395900_0670677_101_661 185
22 3300046615 Ga0495656_0000001 Ga0495656_0000001_102823_103383 185
23 3300046664 Ga0495659_0004651 Ga0495659_0004651_1001_1561 185
24 3300047320 Ga0495672_0333221 Ga0495672_0333221_44_601 185
25 3300049569 Ga0501032_0401309 Ga0501032_0401309_258_815 185
26 3300055283 Ga0500661_005836 Ga0500661_005836_1071_1628 185
27 3300003320 rootH2_10219864 rootH2_102198643 186
28 3300003322 rootL2_10076161 rootL2_100761616 186
29 3300003323 rootH1_10018935 rootH1_100189351 186
30 3300003323 rootH1_10187705 rootH1_101877052 186
31 3300003323 rootH1_10325856 rootH1_103258561 186
32 3300003323 rootH1_10338715 rootH1_103387152 186
33 3300003794 Ga0055531_10000014 Ga0055531_100000144 186
34 3300005548 Ga0070665_100010545 Ga0070665_1000105454 186
35 3300005578 Ga0068854_100314266 Ga0068854_1003142661 186
36 3300009553 Ga0105249_11209680 Ga0105249_112096801 186
37 3300013104 Ga0157370_10346820 Ga0157370_103468202 186
38 3300013104 Ga0157370_11028914 Ga0157370_110289142 186
39 3300013297 Ga0157378_10081855 Ga0157378_100818552 186
40 3300015265 Ga0182005_1000146 Ga0182005_100014621 186
41 3300025304 Ga0209257_1000004 Ga0209257_1000004654 186
42 3300025903 Ga0207680_10048272 Ga0207680_100482723 186
43 3300025986 Ga0207658_10338982 Ga0207658_103389822 186
44 3300026116 Ga0207674_10036039 Ga0207674_100360393 186
45 3300028379 Ga0268266_10006885 Ga0268266_100068853 186
46 3300028794 Ga0307515_10000681 Ga0307515_1000068120 186
47 3300031456 Ga0307513_10061371 Ga0307513_100613713 186
48 3300031616 Ga0307508_10046987 Ga0307508_100469872 186
49 3300031649 Ga0307514_10098970 Ga0307514_100989702 186
50 3300035170 Ga0373943_0027079 Ga0373943_0027079_2074_2634 186
51 3300041997 Ga0439431_0036995 Ga0439431_0036995_39_599 186
52 3300042014 Ga0439457_041547 Ga0439457_041547_204_764 186
53 3300044658 Ga0466972_0000002 Ga0466972_0000002_367798_368358 186
54 3300044735 Ga0466968_0082457 Ga0466968_0082457_768_1328 186
55 3300044765 Ga0466970_0000342 Ga0466970_0000342_21060_21620 186
56 3300046460 Ga0495638_0000013 Ga0495638_0000013_315027_315587 186
57 3300046616 Ga0495668_0001289 Ga0495668_0001289_21099_21659 186
58 3300047320 Ga0495672_0076450 Ga0495672_0076450_460_1020 186
59 3300047320 Ga0495672_0108393 Ga0495672_0108393_477_1037 186
60 3300047472 Ga0495686_0040453 Ga0495686_0040453_1751_2311 186
61 3300048929 Ga0496126_0008638 Ga0496126_0008638_2660_3220 186
62 3300049571 Ga0501034_0338678 Ga0501034_0338678_705_1268 186
63 3300049573 Ga0501037_0433976 Ga0501037_0433976_116_682 186
64 3300049574 Ga0501038_0162080 Ga0501038_0162080_1159_1722 186
65 3300049581 Ga0501047_0387315 Ga0501047_0387315_216_782 186
66 3300049589 Ga0501073_0073321 Ga0501073_0073321_1147_1707 186
67 3300049590 Ga0501074_0089803 Ga0501074_0089803_608_1171 186
68 3300049744 Ga0501083_0003414 Ga0501083_0003414_5694_6254 186
69 3300049758 Ga0501241_000087 Ga0501241_000087_7323_7883 186
70 3300053090 Ga0500646_0051821 Ga0500646_0051821_88_648 186
71 3300053092 Ga0500583_0002138 Ga0500583_0002138_3798_4358 186
72 3300053105 Ga0500557_006455 Ga0500557_006455_1725_2285 186
73 3300053116 Ga0500592_011371 Ga0500592_011371_67_627 186
74 3300053130 Ga0500642_0284620 Ga0500642_0284620_94_654 186
75 3300053157 Ga0500624_003238 Ga0500624_003238_1090_1653 186
76 3300025298 Ga0209050_1000452 Ga0209050_100045271 187
77 3300049571 Ga0501034_0000770 Ga0501034_0000770_45406_45969 187
78 3300049584 Ga0501068_0181072 Ga0501068_0181072_62_625 187
79 3300053153 Ga0500616_0000013 Ga0500616_0000013_446306_446869 187
80 3300003792 Ga0055540_1001036 Ga0055540_10010366 188
81 3300005289 Ga0065704_10113975 Ga0065704_101139752 188
82 3300006177 Ga0075362_10047027 Ga0075362_100470272 188
83 3300025303 Ga0209051_1000128 Ga0209051_100012856 188
84 3300031548 Ga0307408_100541790 Ga0307408_1005417902 188
85 3300031901 Ga0307406_10000605 Ga0307406_100006058 188
86 3300001989 JGI24739J22299_10030579 JGI24739J22299_100305792 189
87 3300003578 Ga0006562J51391_1089446 Ga0006562J51391_10894467 189
88 3300003578 Ga0006562J51391_1089447 Ga0006562J51391_10894472 189
89 3300005288 Ga0065714_10123239 Ga0065714_101232392 189
90 3300006195 Ga0075366_10050196 Ga0075366_100501964 189
91 3300006353 Ga0075370_10045726 Ga0075370_100457263 189
92 3300006353 Ga0075370_10242233 Ga0075370_102422332 189
93 3300006847 Ga0075431_100676717 Ga0075431_1006767172 189
94 3300013100 Ga0157373_10127806 Ga0157373_101278062 189
95 3300013306 Ga0163162_10000494 Ga0163162_1000049425 189
96 3300031456 Ga0307513_10205497 Ga0307513_102054971 189
97 3300031649 Ga0307514_10003247 Ga0307514_1000324720 189
98 3300048928 Ga0496125_0210038 Ga0496125_0210038_144_731 189
99 3300050489 nmdc:mga03683_40008_c1 nmdc:mga03683_40008_c1_373_963 189
100 3300050492 nmdc:mga0yw44_102421_c2 nmdc:mga0yw44_102421_c2_70_660 189
101 3300050496 nmdc:mga07m45_40453_c1 nmdc:mga07m45_40453_c1_941_1510 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

33

184

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e4v-assembly1.cif.gz_B crystal structure of nadh:fmn oxidoreductase like protein in complex with fmn (yp_544701.1) from methylobacillus flagellatus kt at 1.40 a resolution 0.9302 11 182
3hmz-assembly1.cif.gz_A-2 crystal structure of a fmn-binding domain of flavin reductases-like enzyme (sbal_0626) from shewanella baltica os155 at 1.50 a resolution 0.8917 6 179
1i0s-assembly1.cif.gz_A archaeoglobus fulgidus ferric reductase complex with nadp+ 0.8915 25 156
3e4v-assembly1.cif.gz_B crystal structure of nadh:fmn oxidoreductase like protein in complex with fmn (yp_544701.1) from methylobacillus flagellatus kt at 1.40 a resolution 0.8896 11 182
3zoe-assembly1.cif.gz_B crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde 0.8452 21 179
ID Description Score Start End Superfamily
3e4vB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9221 11 182 2.30.110.10
3e4vB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9115 11 182 2.30.110.10
af_P76121_1_188_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.909 10 179 2.30.110.10
1i0sA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8915 25 156 2.30.110.10
af_O53254_5_167_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8844 25 162 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A653UQ58-F1-model_v4 deleted 0.9959 5 164
AF-A0A258SKZ0-F1-model_v4 Flavin reductase 0.9928 9 152 GO:0010181
GO:0016646
AF-A0A4Q5QRB2-F1-model_v4 Flavin reductase family protein 0.9919 11 134 GO:0010181
GO:0016646
AF-K2DLI3-F1-model_v4 Flavin reductase protein 0.988 9 165 GO:0010181
GO:0016646
AF-A0A653UQ58-F1-model_v4 deleted 0.9836 5 164

Feature Viewer

pLDDT pTM Quality
93.54 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map