F001295

General Info

Members Datasets Scaffolds Average Seq Length
100 85 99 153

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100402046|Ga0070667_1004020461
Length 185
Sequence MAMCQFPWKPHSRSGSLIEDGDTSLILEPRDTEFESRVRSSFARQEAMRTFGVTLERVAPGAVDMALPFRADLTQQHGFLHAGVITAVVDSACGYAALSLMEPGTAVLSVEFKVQLLAPARGKRFRALGRVVRTGRTLTVVTGELRAYAQEPARGTASGVVGEGELIALLNGTMMTVRDRQGLAD

Samples

Sample ID Description Type Environment
1 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
53 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
59 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
60 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
61 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
62 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
73 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
74 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
75 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
76 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
77 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
78 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
79 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
83 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
84 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
85 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0
Rhizoplane 5
Rhizosphere 83
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10189962 3300005295 Unclassified 1367
2 Ga0070690_100723742 3300005330 Bacteria 766
3 Ga0070692_10502734 3300005345 Bacteria 786
4 Ga0070675_100058039 3300005354 Bacteria 3192
5 Ga0070671_100003070 3300005355 Bacteria 12982
6 Ga0070674_101161310 3300005356 Bacteria 684
7 Ga0070688_100639986 3300005365 Bacteria 818
8 Ga0070667_100402046 3300005367 Bacteria 1247
9 Ga0070667_100623631 3300005367 Bacteria 994
10 Ga0070709_10160146 3300005434 Unclassified 1564
11 Ga0070701_10003664 3300005438 Bacteria 6121
12 Ga0070694_100677801 3300005444 Bacteria 837
13 Ga0070706_100070024 3300005467 Bacteria 3244
14 Ga0070699_100429071 3300005518 Bacteria 1197
15 Ga0070697_100031244 3300005536 Bacteria 4282
16 Ga0070695_100017166 3300005545 Bacteria 4389
17 Ga0070696_100633754 3300005546 Bacteria 865
18 Ga0070665_100703230 3300005548 Bacteria 1024
19 Ga0070704_100253277 3300005549 Bacteria 1447
20 Ga0070704_100842223 3300005549 Unclassified 822
21 Ga0070664_100014406 3300005564 Bacteria 6447
22 Ga0068854_101181948 3300005578 Bacteria 685
23 Ga0068870_10452015 3300005840 Unclassified 847
24 Ga0068863_100226016 3300005841 Bacteria 1804
25 Ga0068863_100518328 3300005841 Unclassified 1175
26 Ga0068863_101485293 3300005841 Bacteria 686
27 Ga0070715_10097122 3300006163 Bacteria 1367
28 Ga0097621_100239184 3300006237 Bacteria 1587
29 Ga0068865_100754623 3300006881 Unclassified 836
30 Ga0105240_10028583 3300009093 Bacteria 7279
31 Ga0105245_10405867 3300009098 Bacteria 1363
32 Ga0105245_11358668 3300009098 Bacteria 760
33 Ga0105242_10302100 3300009176 Bacteria 1461
34 Ga0105248_12450177 3300009177 Unclassified 594
35 Ga0157378_10458820 3300013297 Bacteria 1266
36 Ga0157378_10826580 3300013297 Unclassified 953
37 Ga0157378_10962701 3300013297 Bacteria 886
38 Ga0157380_10179884 3300014326 Bacteria 1857
39 Ga0157380_10511830 3300014326 Bacteria 1169
40 Ga0157379_10500604 3300014968 Unclassified 1126
41 Ga0157376_10413717 3300014969 Unclassified 1307
42 Ga0213876_10353965 3300021384 Unclassified 781
43 Ga0213875_10000310 3300021388 Bacteria 46673
44 Ga0207643_10127071 3300025908 Unclassified 1514
45 Ga0207695_10337405 3300025913 Bacteria 1395
46 Ga0207681_10555902 3300025923 Bacteria 945
47 Ga0207650_10077382 3300025925 Unclassified 2515
48 Ga0207650_10855190 3300025925 Bacteria 772
49 Ga0207659_10067257 3300025926 Bacteria 2602
50 Ga0207644_10000751 3300025931 Bacteria 20562
51 Ga0207670_10142043 3300025936 Bacteria 1771
52 Ga0207665_10302337 3300025939 Bacteria 1196
53 Ga0207679_10187347 3300025945 Bacteria 1717
54 Ga0207667_10382789 3300025949 Bacteria 1433
55 Ga0207712_11020534 3300025961 Bacteria 734
56 Ga0207641_10175920 3300026088 Unclassified 1957
57 Ga0207641_10220171 3300026088 Bacteria 1760
58 Ga0268266_10234660 3300028379 Bacteria 1691
59 Ga0268264_11552465 3300028381 Bacteria 673
60 Ga0307408_100901092 3300031548 Bacteria 809
61 Ga0316578_10030883 3300031728 Bacteria 3049
62 Ga0316577_10006891 3300031733 Bacteria 6036
63 Ga0307412_10197657 3300031911 Bacteria 1525
64 Ga0307416_100299694 3300032002 Bacteria 1597
65 Ga0307416_101207921 3300032002 Bacteria 862
66 Ga0307416_101232937 3300032002 Bacteria 854
67 Ga0307411_10910808 3300032005 Bacteria 782
68 Ga0307415_100116750 3300032126 Bacteria 1992
69 Ga0316585_10032118 3300032137 Bacteria 1653
70 Ga0307510_10000187 3300033180 Bacteria 53246
71 Ga0373955_0340753 3300035172 Bacteria 907
72 Ga0316574_0077643 3300035398 Bacteria 2105
73 Ga0373931_0148805 3300035691 Bacteria 1363
74 Ga0316584_0002407 3300036712 Bacteria 11824
75 Ga0373925_0234323 3300037068 Bacteria 1469
76 Ga0436364_0149806 3300037853 Bacteria 46869
77 Ga0436364_1135847 3300037853 Unclassified 1357
78 Ga0436365_0370805 3300039437 Bacteria 6571
79 Ga0436365_0620941 3300039437 Unclassified 877
80 Ga0436365_1524166 3300039437 Bacteria 12743
81 Ga0436363_0379430 3300039450 Bacteria 872
82 Ga0451853_1625026 3300041512 Bacteria 517
83 Ga0451577_0464855 3300042876 Bacteria 1149
84 Ga0466963_0626774 3300044694 Bacteria 759
85 Ga0466967_1219868 3300045976 Bacteria 749
86 Ga0495621_0002530 3300046539 Bacteria 4931
87 Ga0495658_0078205 3300046683 Bacteria 1936
88 Ga0495600_0022669 3300046809 Bacteria 4034
89 Ga0495581_0055749 3300047315 Bacteria 2281
90 Ga0495684_0431684 3300047471 Bacteria 919
91 Ga0496100_0006025 3300048903 Bacteria 6581
92 Ga0496101_0793207 3300048904 Unclassified 747
93 Ga0496106_0452732 3300048909 Bacteria 1031
94 Ga0496114_0000222 3300048917 Bacteria 41290
95 Ga0496115_0070574 3300048918 Bacteria 2832
96 Ga0501270_045974 3300049767 Bacteria 776
97 nmdc:mga06z11_540186_c1 3300050494 Unclassified 707
98 nmdc:mga0n895_595551_c1 3300050512 Bacteria 1108
99 Ga0500647_0166258 3300053091 Bacteria 1021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005330 Ga0070690_100723742 Ga0070690_1007237422 127
2 3300005345 Ga0070692_10502734 Ga0070692_105027342 127
3 3300005365 Ga0070688_100639986 Ga0070688_1006399861 127
4 3300005438 Ga0070701_10003664 Ga0070701_100036648 127
5 3300005549 Ga0070704_100842223 Ga0070704_1008422231 127
6 3300025936 Ga0207670_10142043 Ga0207670_101420432 127
7 3300041512 Ga0451853_1625026 Ga0451853_1625026_113_499 128
8 3300035172 Ga0373955_0340753 Ga0373955_0340753_16_405 129
9 3300009098 Ga0105245_11358668 Ga0105245_113586681 145
10 3300046809 Ga0495600_0022669 Ga0495600_0022669_3037_3516 145
11 3300047315 Ga0495581_0055749 Ga0495581_0055749_1710_2189 145
12 3300047471 Ga0495684_0431684 Ga0495684_0431684_399_878 145
13 3300035398 Ga0316574_0077643 Ga0316574_0077643_774_1256 146
14 3300025939 Ga0207665_10302337 Ga0207665_103023372 147
15 3300039437 Ga0436365_1524166 Ga0436365_1524166_10371_10820 147
16 3300005356 Ga0070674_101161310 Ga0070674_1011613101 148
17 3300013297 Ga0157378_10962701 Ga0157378_109627011 149
18 3300005354 Ga0070675_100058039 Ga0070675_1000580395 150
19 3300005367 Ga0070667_100623631 Ga0070667_1006236312 150
20 3300005444 Ga0070694_100677801 Ga0070694_1006778011 150
21 3300005518 Ga0070699_100429071 Ga0070699_1004290712 150
22 3300005545 Ga0070695_100017166 Ga0070695_1000171662 150
23 3300005546 Ga0070696_100633754 Ga0070696_1006337542 150
24 3300005548 Ga0070665_100703230 Ga0070665_1007032302 150
25 3300005564 Ga0070664_100014406 Ga0070664_1000144063 150
26 3300005578 Ga0068854_101181948 Ga0068854_1011819481 150
27 3300005840 Ga0068870_10452015 Ga0068870_104520151 150
28 3300005841 Ga0068863_100226016 Ga0068863_1002260162 150
29 3300005841 Ga0068863_101485293 Ga0068863_1014852932 150
30 3300009176 Ga0105242_10302100 Ga0105242_103021002 150
31 3300009177 Ga0105248_12450177 Ga0105248_124501771 150
32 3300013297 Ga0157378_10458820 Ga0157378_104588202 150
33 3300014326 Ga0157380_10179884 Ga0157380_101798843 150
34 3300014968 Ga0157379_10500604 Ga0157379_105006042 150
35 3300014969 Ga0157376_10413717 Ga0157376_104137172 150
36 3300025908 Ga0207643_10127071 Ga0207643_101270712 150
37 3300025923 Ga0207681_10555902 Ga0207681_105559022 150
38 3300025925 Ga0207650_10077382 Ga0207650_100773823 150
39 3300025925 Ga0207650_10855190 Ga0207650_108551901 150
40 3300025926 Ga0207659_10067257 Ga0207659_100672572 150
41 3300025945 Ga0207679_10187347 Ga0207679_101873473 150
42 3300025949 Ga0207667_10382789 Ga0207667_103827892 150
43 3300025961 Ga0207712_11020534 Ga0207712_110205342 150
44 3300026088 Ga0207641_10220171 Ga0207641_102201712 150
45 3300028379 Ga0268266_10234660 Ga0268266_102346602 150
46 3300028381 Ga0268264_11552465 Ga0268264_115524651 150
47 3300031548 Ga0307408_100901092 Ga0307408_1009010922 150
48 3300031728 Ga0316578_10030883 Ga0316578_100308832 150
49 3300031733 Ga0316577_10006891 Ga0316577_100068914 150
50 3300032002 Ga0307416_101207921 Ga0307416_1012079212 150
51 3300032005 Ga0307411_10910808 Ga0307411_109108082 150
52 3300032126 Ga0307415_100116750 Ga0307415_1001167504 150
53 3300032137 Ga0316585_10032118 Ga0316585_100321181 150
54 3300035691 Ga0373931_0148805 Ga0373931_0148805_316_768 150
55 3300036712 Ga0316584_0002407 Ga0316584_0002407_10183_10656 150
56 3300037068 Ga0373925_0234323 Ga0373925_0234323_819_1271 150
57 3300037853 Ga0436364_1135847 Ga0436364_1135847_230_706 150
58 3300039450 Ga0436363_0379430 Ga0436363_0379430_133_627 150
59 3300042876 Ga0451577_0464855 Ga0451577_0464855_61_522 150
60 3300046539 Ga0495621_0002530 Ga0495621_0002530_4317_4769 150
61 3300050494 nmdc:mga06z11_540186_c1 nmdc:mga06z11_540186_c1_110_562 150
62 iso_pu_bacteria 2881927736 2881931474 150
63 3300006237 Ga0097621_100239184 Ga0097621_1002391843 151
64 3300021384 Ga0213876_10353965 Ga0213876_103539651 151
65 3300021388 Ga0213875_10000310 Ga0213875_1000031026 151
66 3300032002 Ga0307416_101232937 Ga0307416_1012329371 151
67 3300037853 Ga0436364_0149806 Ga0436364_0149806_22204_22671 151
68 3300039437 Ga0436365_0620941 Ga0436365_0620941_295_753 151
69 3300048903 Ga0496100_0006025 Ga0496100_0006025_516_971 151
70 3300048904 Ga0496101_0793207 Ga0496101_0793207_204_659 151
71 3300048909 Ga0496106_0452732 Ga0496106_0452732_542_997 151
72 3300048917 Ga0496114_0000222 Ga0496114_0000222_9304_9759 151
73 3300048918 Ga0496115_0070574 Ga0496115_0070574_417_872 151
74 3300005467 Ga0070706_100070024 Ga0070706_1000700242 152
75 3300005536 Ga0070697_100031244 Ga0070697_1000312441 152
76 3300006163 Ga0070715_10097122 Ga0070715_100971222 152
77 3300009098 Ga0105245_10405867 Ga0105245_104058672 152
78 3300032002 Ga0307416_100299694 Ga0307416_1002996943 152
79 3300033180 Ga0307510_10000187 Ga0307510_1000018716 152
80 3300039437 Ga0436365_0370805 Ga0436365_0370805_5409_5870 152
81 3300046683 Ga0495658_0078205 Ga0495658_0078205_1443_1901 152
82 3300049767 Ga0501270_045974 Ga0501270_045974_289_747 152
83 3300053091 Ga0500647_0166258 Ga0500647_0166258_377_844 152
84 3300005434 Ga0070709_10160146 Ga0070709_101601462 154
85 3300031911 Ga0307412_10197657 Ga0307412_101976572 154
86 3300050512 nmdc:mga0n895_595551_c1 nmdc:mga0n895_595551_c1_76_570 154
87 3300009093 Ga0105240_10028583 Ga0105240_100285832 155
88 3300025913 Ga0207695_10337405 Ga0207695_103374052 155
89 3300005295 Ga0065707_10189962 Ga0065707_101899622 157
90 3300005355 Ga0070671_100003070 Ga0070671_10000307015 157
91 3300005367 Ga0070667_100402046 Ga0070667_1004020461 157
92 3300005549 Ga0070704_100253277 Ga0070704_1002532772 157
93 3300005841 Ga0068863_100518328 Ga0068863_1005183282 157
94 3300006881 Ga0068865_100754623 Ga0068865_1007546232 157
95 3300013297 Ga0157378_10826580 Ga0157378_108265802 157
96 3300014326 Ga0157380_10511830 Ga0157380_105118301 157
97 3300025931 Ga0207644_10000751 Ga0207644_1000075115 157
98 3300026088 Ga0207641_10175920 Ga0207641_101759203 157
99 3300044694 Ga0466963_0626774 Ga0466963_0626774_258_734 157
100 3300045976 Ga0466967_1219868 Ga0466967_1219868_65_541 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

77

152

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e1e-assembly1.cif.gz_B crystal structure of a thioesterase family protein from silicibacter pomeroyi. northeast structural genomics target sir180a 0.9415 5 151
3e1e-assembly1.cif.gz_B crystal structure of a thioesterase family protein from silicibacter pomeroyi. northeast structural genomics target sir180a 0.935 5 151
2fs2-assembly1.cif.gz_B structure of the e. coli paai protein from the phyenylacetic acid degradation operon 0.9148 9 149
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9121 21 150
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.9001 21 148
ID Description Score Start End Superfamily
3e1eD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9407 10 151 3.10.129.10
3e1eD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.921 10 151 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8998 21 148 3.10.129.10
2fs2B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8939 10 149 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8896 20 147 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1Q7IQX8-F1-model_v4 Thioesterase domain-containing protein 0.9599 1 127 GO:0047617
AF-A0A7W0NW46-F1-model_v4 PaaI family thioesterase 0.959 1 152 GO:0047617
AF-A0A1Q7ETX6-F1-model_v4 Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) 0.9578 1 123 GO:0016289
AF-A0A364NY55-F1-model_v4 Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) 0.9565 4 149 GO:0016289
AF-A0A238K220-F1-model_v4 Thioesterase domain-containing protein 0.9564 4 151 GO:0047617

Feature Viewer

pLDDT pTM Quality
92.36 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map