F485821

General Info

Members Datasets Scaffolds Average Seq Length
923 258 923 137

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100000424|Ga0070713_1000004246
Length 153
Sequence MNEDRIVPDSSEYSGVRRPRNRKPASGNWNPDWEPFAELDPAWTEKVIAMAISPAVSGALDPKTIELIGIALDVSCANMYAPGVRRHIQRALKAGATREQITAVLQLASMQGLHSMCLGAPILLAELEASSERKGRLSSNTRQPKATLQRKRP

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
93 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
174 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
175 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
195 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.88
Rhizosphere 94.69
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002012 3300001976 Bacteria 2710
2 JGI24738J21930_10038243 3300002075 Bacteria 975
3 JGI24034J26672_10005355 3300002239 Bacteria 1838
4 JGI24034J26672_10049560 3300002239 Bacteria 720
5 Ga0065704_10676556 3300005289 Unclassified 571
6 Ga0065712_10015926 3300005290 Bacteria 1915
7 Ga0065712_10493920 3300005290 Bacteria 654
8 Ga0065715_10003738 3300005293 Bacteria 4577
9 Ga0065715_10130541 3300005293 Bacteria 2024
10 Ga0065715_10499012 3300005293 Bacteria 781
11 Ga0070658_10286898 3300005327 Bacteria 1402
12 Ga0070658_10834358 3300005327 Bacteria 801
13 Ga0070676_10006276 3300005328 Bacteria 6349
14 Ga0070676_10018010 3300005328 Bacteria 3912
15 Ga0070676_10018765 3300005328 Bacteria 3838
16 Ga0070676_10046474 3300005328 Bacteria 2532
17 Ga0070676_10366648 3300005328 Bacteria 994
18 Ga0070683_100046360 3300005329 Bacteria 4015
19 Ga0070690_100001139 3300005330 Bacteria 13686
20 Ga0070690_100021447 3300005330 Bacteria 3945
21 Ga0070690_100033209 3300005330 Bacteria 3228
22 Ga0070690_100131175 3300005330 Bacteria 1692
23 Ga0070690_100788722 3300005330 Bacteria 736
24 Ga0070670_100001678 3300005331 Bacteria 17974
25 Ga0070670_100025285 3300005331 Bacteria 5109
26 Ga0070670_100128604 3300005331 Bacteria 2186
27 Ga0070670_100146833 3300005331 Bacteria 2040
28 Ga0070670_100281362 3300005331 Unclassified 1452
29 Ga0070670_100351719 3300005331 Bacteria 1294
30 Ga0070670_100356816 3300005331 Bacteria 1285
31 Ga0070670_100423911 3300005331 Bacteria 1176
32 Ga0070670_100471007 3300005331 Bacteria 1115
33 Ga0070670_100538010 3300005331 Bacteria 1041
34 Ga0070670_100872860 3300005331 Bacteria 815
35 Ga0070670_101004107 3300005331 Bacteria 759
36 Ga0070677_10011152 3300005333 Bacteria 3091
37 Ga0070677_10641973 3300005333 Bacteria 592
38 Ga0068869_100013466 3300005334 Bacteria 5441
39 Ga0068869_100036189 3300005334 Bacteria 3504
40 Ga0068869_100102712 3300005334 Bacteria 2165
41 Ga0068869_102097676 3300005334 Bacteria 508
42 Ga0070666_10002296 3300005335 Bacteria 11558
43 Ga0070666_10042890 3300005335 Bacteria 3027
44 Ga0070666_10427625 3300005335 Unclassified 954
45 Ga0070666_10508297 3300005335 Bacteria 874
46 Ga0070666_10762429 3300005335 Bacteria 711
47 Ga0070682_100234857 3300005337 Bacteria 1313
48 Ga0070682_100725287 3300005337 Unclassified 800
49 Ga0068868_100002830 3300005338 Bacteria 12020
50 Ga0068868_100038068 3300005338 Bacteria 3732
51 Ga0068868_100091422 3300005338 Bacteria 2452
52 Ga0068868_100268493 3300005338 Bacteria 1441
53 Ga0068868_100389266 3300005338 Bacteria 1201
54 Ga0070660_100003276 3300005339 Bacteria 11120
55 Ga0070660_100031003 3300005339 Bacteria 4013
56 Ga0070660_100256953 3300005339 Bacteria 1426
57 Ga0070689_100001809 3300005340 Bacteria 13750
58 Ga0070689_100048305 3300005340 Bacteria 3282
59 Ga0070689_100159834 3300005340 Bacteria 1821
60 Ga0070689_100431279 3300005340 Bacteria 1119
61 Ga0070689_100577174 3300005340 Bacteria 972
62 Ga0070687_100730051 3300005343 Bacteria 695
63 Ga0070661_100001085 3300005344 Bacteria 19256
64 Ga0070661_100090788 3300005344 Bacteria 2262
65 Ga0070661_100764013 3300005344 Bacteria 791
66 Ga0070692_10245793 3300005345 Bacteria 1068
67 Ga0070668_100000374 3300005347 Bacteria 29621
68 Ga0070668_100016207 3300005347 Bacteria 5576
69 Ga0070668_100024546 3300005347 Bacteria 4569
70 Ga0070668_100047142 3300005347 Bacteria 3312
71 Ga0070668_100154733 3300005347 Bacteria 1857
72 Ga0070668_100184178 3300005347 Bacteria 1707
73 Ga0070668_100268362 3300005347 Bacteria 1422
74 Ga0070668_100278411 3300005347 Bacteria 1396
75 Ga0070668_100544472 3300005347 Bacteria 1010
76 Ga0070668_100549530 3300005347 Unclassified 1005
77 Ga0070668_101508636 3300005347 Bacteria 614
78 Ga0070668_101896924 3300005347 Unclassified 549
79 Ga0070669_100016453 3300005353 Bacteria 5276
80 Ga0070669_100073880 3300005353 Bacteria 2527
81 Ga0070669_100092795 3300005353 Bacteria 2266
82 Ga0070669_100095576 3300005353 Bacteria 2235
83 Ga0070669_100284732 3300005353 Bacteria 1325
84 Ga0070669_100359315 3300005353 Bacteria 1184
85 Ga0070669_100394079 3300005353 Bacteria 1132
86 Ga0070669_100672393 3300005353 Bacteria 872
87 Ga0070669_100759715 3300005353 Bacteria 822
88 Ga0070669_100844896 3300005353 Bacteria 780
89 Ga0070669_100852370 3300005353 Bacteria 776
90 Ga0070675_100003331 3300005354 Bacteria 12170
91 Ga0070675_100004304 3300005354 Bacteria 10851
92 Ga0070675_100018349 3300005354 Bacteria 5567
93 Ga0070675_100039515 3300005354 Bacteria 3851
94 Ga0070675_100391028 3300005354 Bacteria 1239
95 Ga0070675_100493742 3300005354 Bacteria 1102
96 Ga0070675_100792360 3300005354 Bacteria 866
97 Ga0070675_100881348 3300005354 Bacteria 820
98 Ga0070675_100882104 3300005354 Bacteria 819
99 Ga0070675_100914704 3300005354 Bacteria 804
100 Ga0070675_100990021 3300005354 Bacteria 772
101 Ga0070671_100001994 3300005355 Bacteria 15672
102 Ga0070671_100020844 3300005355 Bacteria 5347
103 Ga0070671_100038268 3300005355 Bacteria 3981
104 Ga0070671_100041455 3300005355 Bacteria 3826
105 Ga0070671_100071122 3300005355 Bacteria 2903
106 Ga0070671_100103944 3300005355 Bacteria 2384
107 Ga0070671_100271107 3300005355 Bacteria 1443
108 Ga0070671_100534921 3300005355 Bacteria 1010
109 Ga0070671_100758577 3300005355 Unclassified 843
110 Ga0070671_101047531 3300005355 Bacteria 716
111 Ga0070671_101110178 3300005355 Bacteria 695
112 Ga0070674_100024754 3300005356 Bacteria 3899
113 Ga0070674_100138584 3300005356 Bacteria 1823
114 Ga0070674_100155617 3300005356 Bacteria 1729
115 Ga0070674_100485717 3300005356 Bacteria 1026
116 Ga0070674_100658750 3300005356 Bacteria 891
117 Ga0070674_101250286 3300005356 Bacteria 660
118 Ga0070673_100006326 3300005364 Bacteria 7692
119 Ga0070673_100009947 3300005364 Bacteria 6411
120 Ga0070673_100029371 3300005364 Bacteria 4099
121 Ga0070673_100042033 3300005364 Bacteria 3521
122 Ga0070673_100044131 3300005364 Bacteria 3450
123 Ga0070673_100248097 3300005364 Bacteria 1551
124 Ga0070673_100352505 3300005364 Bacteria 1306
125 Ga0070673_100415718 3300005364 Bacteria 1205
126 Ga0070673_100431764 3300005364 Bacteria 1182
127 Ga0070673_100612393 3300005364 Bacteria 994
128 Ga0070688_100029155 3300005365 Bacteria 3302
129 Ga0070688_100040461 3300005365 Bacteria 2856
130 Ga0070688_100323661 3300005365 Bacteria 1121
131 Ga0070688_100832494 3300005365 Bacteria 724
132 Ga0070688_101431114 3300005365 Bacteria 561
133 Ga0070659_100007565 3300005366 Bacteria 7895
134 Ga0070659_100083410 3300005366 Bacteria 2554
135 Ga0070659_100098361 3300005366 Bacteria 2353
136 Ga0070659_100233368 3300005366 Bacteria 1521
137 Ga0070659_101008631 3300005366 Bacteria 731
138 Ga0070667_100026344 3300005367 Unclassified 4836
139 Ga0070667_100034520 3300005367 Bacteria 4232
140 Ga0070667_100071133 3300005367 Bacteria 2962
141 Ga0070667_100078488 3300005367 Bacteria 2821
142 Ga0070667_100102223 3300005367 Bacteria 2476
143 Ga0070667_100102596 3300005367 Bacteria 2472
144 Ga0070667_100254525 3300005367 Bacteria 1570
145 Ga0070667_100445074 3300005367 Bacteria 1183
146 Ga0070667_100511293 3300005367 Bacteria 1102
147 Ga0070667_100925567 3300005367 Unclassified 812
148 Ga0070667_101189224 3300005367 Bacteria 713
149 Ga0070667_101510584 3300005367 Bacteria 631
150 Ga0070709_10286028 3300005434 Bacteria 1200
151 Ga0070713_100000424 3300005436 Bacteria 26974
152 Ga0070713_100050119 3300005436 Bacteria 3447
153 Ga0070710_10149882 3300005437 Bacteria 1438
154 Ga0070710_11170573 3300005437 Unclassified 567
155 Ga0070701_10055555 3300005438 Bacteria 2069
156 Ga0070701_10974020 3300005438 Unclassified 590
157 Ga0070711_101073288 3300005439 Bacteria 693
158 Ga0070705_100170336 3300005440 Bacteria 1465
159 Ga0070705_100580069 3300005440 Bacteria 864
160 Ga0070700_100032042 3300005441 Bacteria 3156
161 Ga0070700_100926501 3300005441 Bacteria 711
162 Ga0070700_101008293 3300005441 Bacteria 685
163 Ga0070700_101113885 3300005441 Unclassified 655
164 Ga0070663_100054084 3300005455 Bacteria 2868
165 Ga0070663_100152575 3300005455 Bacteria 1772
166 Ga0070663_100452734 3300005455 Bacteria 1058
167 Ga0070663_100586541 3300005455 Bacteria 936
168 Ga0070678_100045678 3300005456 Bacteria 3135
169 Ga0070678_100060857 3300005456 Bacteria 2781
170 Ga0070678_100098619 3300005456 Bacteria 2259
171 Ga0070678_100170102 3300005456 Bacteria 1774
172 Ga0070678_100353604 3300005456 Unclassified 1264
173 Ga0070678_100446965 3300005456 Bacteria 1131
174 Ga0070662_100000248 3300005457 Bacteria 31890
175 Ga0070662_100163914 3300005457 Unclassified 1740
176 Ga0070662_100674522 3300005457 Unclassified 873
177 Ga0070662_101053928 3300005457 Bacteria 697
178 Ga0068867_100016598 3300005459 Bacteria 5229
179 Ga0068867_100017814 3300005459 Bacteria 5044
180 Ga0068867_100095906 3300005459 Bacteria 2257
181 Ga0068867_100147138 3300005459 Bacteria 1847
182 Ga0068867_100177835 3300005459 Bacteria 1690
183 Ga0068867_100326117 3300005459 Bacteria 1274
184 Ga0068867_100402025 3300005459 Bacteria 1155
185 Ga0068867_101688919 3300005459 Unclassified 593
186 Ga0068867_101802437 3300005459 Unclassified 575
187 Ga0070685_10130867 3300005466 Bacteria 1569
188 Ga0070685_10471119 3300005466 Bacteria 883
189 Ga0070685_11049051 3300005466 Bacteria 614
190 Ga0070679_100364767 3300005530 Bacteria 1392
191 Ga0070679_100381424 3300005530 Bacteria 1356
192 Ga0070679_101745310 3300005530 Unclassified 571
193 Ga0070684_100128048 3300005535 Bacteria 2289
194 Ga0068853_100004274 3300005539 Bacteria 11036
195 Ga0068853_100154067 3300005539 Bacteria 2070
196 Ga0068853_100377202 3300005539 Bacteria 1324
197 Ga0068853_100457054 3300005539 Bacteria 1201
198 Ga0068853_100991127 3300005539 Bacteria 809
199 Ga0068853_101293217 3300005539 Bacteria 705
200 Ga0070672_100002393 3300005543 Bacteria 11877
201 Ga0070672_100002980 3300005543 Bacteria 10907
202 Ga0070672_100005788 3300005543 Bacteria 8243
203 Ga0070672_100026381 3300005543 Bacteria 4322
204 Ga0070672_100037099 3300005543 Bacteria 3717
205 Ga0070672_100466241 3300005543 Bacteria 1089
206 Ga0070672_100481411 3300005543 Bacteria 1072
207 Ga0070672_100536813 3300005543 Bacteria 1014
208 Ga0070672_100657603 3300005543 Bacteria 915
209 Ga0070672_100669203 3300005543 Bacteria 907
210 Ga0070672_101260256 3300005543 Bacteria 659
211 Ga0070672_101837321 3300005543 Bacteria 545
212 Ga0070686_100905738 3300005544 Bacteria 718
213 Ga0070696_101110954 3300005546 Bacteria 665
214 Ga0070693_100010185 3300005547 Bacteria 4700
215 Ga0070665_100018631 3300005548 Bacteria 6957
216 Ga0070665_100091056 3300005548 Bacteria 3055
217 Ga0070665_100551585 3300005548 Bacteria 1165
218 Ga0070704_100734616 3300005549 Bacteria 878
219 Ga0068855_100001259 3300005563 Bacteria 31467
220 Ga0068855_100058236 3300005563 Bacteria 4526
221 Ga0068855_100312328 3300005563 Bacteria 1739
222 Ga0068855_100868097 3300005563 Bacteria 955
223 Ga0068855_101486415 3300005563 Bacteria 696
224 Ga0070664_100005493 3300005564 Bacteria 10179
225 Ga0070664_100138061 3300005564 Bacteria 2145
226 Ga0070664_100160027 3300005564 Bacteria 1992
227 Ga0070664_100577288 3300005564 Bacteria 1041
228 Ga0070664_100905950 3300005564 Bacteria 827
229 Ga0068857_100045071 3300005577 Bacteria 3912
230 Ga0068857_100192957 3300005577 Bacteria 1855
231 Ga0068857_100338907 3300005577 Bacteria 1391
232 Ga0068854_100040078 3300005578 Bacteria 3303
233 Ga0068854_100080515 3300005578 Bacteria 2404
234 Ga0068854_100902555 3300005578 Bacteria 777
235 Ga0068856_100000181 3300005614 Bacteria 65631
236 Ga0068856_100031280 3300005614 Bacteria 5206
237 Ga0068856_101555903 3300005614 Bacteria 675
238 Ga0070702_100030022 3300005615 Bacteria 2960
239 Ga0070702_100121224 3300005615 Bacteria 1637
240 Ga0070702_100324125 3300005615 Bacteria 1075
241 Ga0070702_101304457 3300005615 Bacteria 590
242 Ga0068852_100042015 3300005616 Bacteria 3868
243 Ga0068852_100166816 3300005616 Bacteria 2061
244 Ga0068852_100228231 3300005616 Bacteria 1774
245 Ga0068852_100312737 3300005616 Bacteria 1523
246 Ga0068852_100457470 3300005616 Bacteria 1264
247 Ga0068852_100954428 3300005616 Bacteria 875
248 Ga0068852_101087464 3300005616 Bacteria 820
249 Ga0068859_100021504 3300005617 Bacteria 6475
250 Ga0068859_100042909 3300005617 Bacteria 4544
251 Ga0068859_100050149 3300005617 Bacteria 4193
252 Ga0068859_100075709 3300005617 Bacteria 3406
253 Ga0068859_100410842 3300005617 Bacteria 1450
254 Ga0068859_100495589 3300005617 Bacteria 1317
255 Ga0068859_102086085 3300005617 Unclassified 626
256 Ga0068859_102517368 3300005617 Unclassified 566
257 Ga0068864_100005689 3300005618 Bacteria 10218
258 Ga0068864_100007820 3300005618 Bacteria 8810
259 Ga0068864_100012219 3300005618 Bacteria 7095
260 Ga0068864_100026230 3300005618 Bacteria 4913
261 Ga0068864_100056646 3300005618 Unclassified 3386
262 Ga0068864_100806923 3300005618 Bacteria 923
263 Ga0068864_101177177 3300005618 Bacteria 765
264 Ga0068864_101906473 3300005618 Bacteria 600
265 Ga0068866_10103463 3300005718 Bacteria 1575
266 Ga0068866_10215490 3300005718 Bacteria 1155
267 Ga0068866_10255947 3300005718 Bacteria 1073
268 Ga0068861_100070825 3300005719 Bacteria 2701
269 Ga0068861_100187476 3300005719 Bacteria 1726
270 Ga0068861_100249845 3300005719 Bacteria 1513
271 Ga0068861_100251229 3300005719 Bacteria 1509
272 Ga0068861_100288357 3300005719 Bacteria 1416
273 Ga0068861_100472824 3300005719 Bacteria 1127
274 Ga0068861_100558031 3300005719 Bacteria 1045
275 Ga0068861_100875224 3300005719 Bacteria 849
276 Ga0068861_101238494 3300005719 Unclassified 723
277 Ga0068861_102259578 3300005719 Bacteria 545
278 Ga0068851_10039544 3300005834 Bacteria 2369
279 Ga0068851_10585496 3300005834 Bacteria 677
280 Ga0068851_10702225 3300005834 Bacteria 623
281 Ga0068851_10874127 3300005834 Bacteria 562
282 Ga0068870_10009446 3300005840 Bacteria 4437
283 Ga0068870_10041457 3300005840 Bacteria 2392
284 Ga0068870_10103862 3300005840 Unclassified 1611
285 Ga0068870_10104265 3300005840 Bacteria 1609
286 Ga0068870_10553142 3300005840 Bacteria 775
287 Ga0068863_100004758 3300005841 Bacteria 13376
288 Ga0068863_100040268 3300005841 Bacteria 4443
289 Ga0068863_100082816 3300005841 Bacteria 3040
290 Ga0068863_100087393 3300005841 Bacteria 2954
291 Ga0068863_100132790 3300005841 Bacteria 2377
292 Ga0068863_100133549 3300005841 Bacteria 2370
293 Ga0068863_100184831 3300005841 Bacteria 2001
294 Ga0068863_100245339 3300005841 Bacteria 1729
295 Ga0068863_100257268 3300005841 Bacteria 1687
296 Ga0068863_100329348 3300005841 Bacteria 1485
297 Ga0068863_100416053 3300005841 Bacteria 1316
298 Ga0068863_100614551 3300005841 Bacteria 1076
299 Ga0068863_101746429 3300005841 Bacteria 632
300 Ga0068863_102358865 3300005841 Bacteria 542
301 Ga0068858_100009481 3300005842 Bacteria 9286
302 Ga0068858_100014857 3300005842 Bacteria 7324
303 Ga0068858_100412343 3300005842 Bacteria 1298
304 Ga0068858_100425777 3300005842 Bacteria 1277
305 Ga0068860_100011978 3300005843 Bacteria 8543
306 Ga0068860_100179498 3300005843 Bacteria 2046
307 Ga0068860_100357363 3300005843 Bacteria 1438
308 Ga0068860_100693951 3300005843 Bacteria 1027
309 Ga0068860_100737000 3300005843 Bacteria 996
310 Ga0068860_100739959 3300005843 Bacteria 994
311 Ga0068860_100784480 3300005843 Bacteria 966
312 Ga0068860_101077104 3300005843 Bacteria 823
313 Ga0068860_102051919 3300005843 Bacteria 593
314 Ga0068862_100040162 3300005844 Bacteria 3977
315 Ga0068862_100178845 3300005844 Bacteria 1903
316 Ga0068862_100553737 3300005844 Bacteria 1098
317 Ga0068862_100699260 3300005844 Bacteria 982
318 Ga0068862_101574161 3300005844 Bacteria 664
319 Ga0070716_100018307 3300006173 Bacteria 3647
320 Ga0070712_100263917 3300006175 Bacteria 1381
321 Ga0070712_100292287 3300006175 Bacteria 1316
322 Ga0097621_100001216 3300006237 Bacteria 17824
323 Ga0097621_100130443 3300006237 Bacteria 2139
324 Ga0097621_100132403 3300006237 Bacteria 2123
325 Ga0097621_100172069 3300006237 Bacteria 1867
326 Ga0097621_100298852 3300006237 Bacteria 1421
327 Ga0097621_100359234 3300006237 Bacteria 1297
328 Ga0097621_100761764 3300006237 Bacteria 895
329 Ga0097621_101888434 3300006237 Unclassified 570
330 Ga0068871_100041708 3300006358 Bacteria 3681
331 Ga0068871_100144622 3300006358 Bacteria 2023
332 Ga0068871_100159519 3300006358 Bacteria 1928
333 Ga0068871_100257370 3300006358 Bacteria 1522
334 Ga0068871_100365152 3300006358 Bacteria 1279
335 Ga0068871_100395545 3300006358 Bacteria 1230
336 Ga0068871_100591838 3300006358 Bacteria 1008
337 Ga0068871_100950877 3300006358 Unclassified 798
338 Ga0075428_101274171 3300006844 Bacteria 773
339 Ga0075433_10213554 3300006852 Unclassified 1714
340 Ga0075434_100416213 3300006871 Bacteria 1365
341 Ga0075434_101018218 3300006871 Bacteria 842
342 Ga0068865_100231314 3300006881 Bacteria 1450
343 Ga0068865_100341818 3300006881 Bacteria 1210
344 Ga0068865_100677128 3300006881 Unclassified 879
345 Ga0068865_100933105 3300006881 Bacteria 756
346 Ga0068865_101652661 3300006881 Bacteria 577
347 Ga0097620_100021504 3300006931 Bacteria 6475
348 Ga0097620_100042908 3300006931 Bacteria 4544
349 Ga0097620_100050148 3300006931 Bacteria 4193
350 Ga0097620_100075706 3300006931 Bacteria 3406
351 Ga0097620_100410829 3300006931 Bacteria 1450
352 Ga0097620_100495613 3300006931 Bacteria 1317
353 Ga0097620_102085607 3300006931 Unclassified 626
354 Ga0097620_102517377 3300006931 Unclassified 566
355 Ga0075435_100221938 3300007076 Bacteria 1605
356 Ga0105251_10576585 3300009011 Bacteria 532
357 Ga0111539_10145942 3300009094 Bacteria 2770
358 Ga0111539_10306782 3300009094 Bacteria 1847
359 Ga0111539_12894717 3300009094 Unclassified 555
360 Ga0105245_10054914 3300009098 Bacteria 3577
361 Ga0105245_10106559 3300009098 Bacteria 2601
362 Ga0105245_10604356 3300009098 Bacteria 1123
363 Ga0105245_10712698 3300009098 Bacteria 1037
364 Ga0105247_10059653 3300009101 Bacteria 2362
365 Ga0105247_10073631 3300009101 Bacteria 2141
366 Ga0105247_10554085 3300009101 Bacteria 846
367 Ga0105247_10739931 3300009101 Unclassified 744
368 Ga0105243_10224778 3300009148 Bacteria 1661
369 Ga0105243_10530608 3300009148 Bacteria 1121
370 Ga0105243_11347215 3300009148 Bacteria 732
371 Ga0105241_10099424 3300009174 Bacteria 2310
372 Ga0105242_10141206 3300009176 Bacteria 2090
373 Ga0105242_10990026 3300009176 Bacteria 848
374 Ga0105242_11044514 3300009176 Bacteria 828
375 Ga0105248_10028146 3300009177 Bacteria 6259
376 Ga0105248_10028894 3300009177 Bacteria 6181
377 Ga0105248_10033967 3300009177 Bacteria 5701
378 Ga0105248_10065291 3300009177 Bacteria 4086
379 Ga0105248_10187349 3300009177 Bacteria 2332
380 Ga0105248_10243116 3300009177 Bacteria 2026
381 Ga0105248_10982603 3300009177 Bacteria 954
382 Ga0105248_11054633 3300009177 Bacteria 918
383 Ga0105248_12791604 3300009177 Unclassified 557
384 Ga0105237_10127731 3300009545 Bacteria 2536
385 Ga0105237_10568705 3300009545 Bacteria 1140
386 Ga0105237_11051590 3300009545 Bacteria 821
387 Ga0105238_10174574 3300009551 Bacteria 2125
388 Ga0105238_10950276 3300009551 Bacteria 879
389 Ga0105238_11116781 3300009551 Bacteria 811
390 Ga0105249_10141192 3300009553 Bacteria 2310
391 Ga0105249_10157287 3300009553 Bacteria 2193
392 Ga0105249_10671047 3300009553 Bacteria 1095
393 Ga0105249_11186480 3300009553 Bacteria 834
394 Ga0105239_10179968 3300010375 Bacteria 2365
395 Ga0105239_10335619 3300010375 Bacteria 1706
396 Ga0105246_10015957 3300011119 Bacteria 4751
397 Ga0157313_1031620 3300012503 Unclassified 604
398 Ga0157327_1057345 3300012512 Bacteria 571
399 Ga0157371_10274012 3300013102 Bacteria 1218
400 Ga0157371_10432281 3300013102 Bacteria 966
401 Ga0157370_10022983 3300013104 Bacteria 6196
402 Ga0157370_10424880 3300013104 Bacteria 1222
403 Ga0157369_10005645 3300013105 Bacteria 14536
404 Ga0157369_10112967 3300013105 Bacteria 2886
405 Ga0157369_10156053 3300013105 Bacteria 2411
406 Ga0157374_10001806 3300013296 Bacteria 18015
407 Ga0157374_10026573 3300013296 Bacteria 5210
408 Ga0157374_10031470 3300013296 Bacteria 4823
409 Ga0157374_11214770 3300013296 Bacteria 775
410 Ga0157374_11425163 3300013296 Bacteria 716
411 Ga0157378_10024096 3300013297 Bacteria 5353
412 Ga0157378_10025030 3300013297 Bacteria 5257
413 Ga0157378_10037169 3300013297 Bacteria 4312
414 Ga0157378_10057589 3300013297 Bacteria 3464
415 Ga0157378_10174802 3300013297 Bacteria 2016
416 Ga0157378_10257898 3300013297 Bacteria 1672
417 Ga0157378_11194211 3300013297 Bacteria 800
418 Ga0157378_12209362 3300013297 Bacteria 601
419 Ga0163162_10005239 3300013306 Bacteria 12498
420 Ga0163162_10030584 3300013306 Bacteria 5335
421 Ga0163162_10167876 3300013306 Bacteria 2318
422 Ga0163162_10210375 3300013306 Bacteria 2074
423 Ga0163162_10399523 3300013306 Bacteria 1507
424 Ga0163162_10650675 3300013306 Bacteria 1178
425 Ga0163162_10667578 3300013306 Bacteria 1162
426 Ga0163162_10771836 3300013306 Bacteria 1080
427 Ga0163162_10862073 3300013306 Bacteria 1020
428 Ga0163162_12178896 3300013306 Bacteria 636
429 Ga0157372_10153192 3300013307 Bacteria 2661
430 Ga0157372_10412591 3300013307 Bacteria 1574
431 Ga0157372_11086970 3300013307 Bacteria 925
432 Ga0157372_13311173 3300013307 Bacteria 513
433 Ga0157375_10006814 3300013308 Bacteria 9948
434 Ga0157375_10011665 3300013308 Bacteria 7765
435 Ga0157375_10357898 3300013308 Bacteria 1626
436 Ga0157375_10387885 3300013308 Bacteria 1563
437 Ga0157375_10521880 3300013308 Bacteria 1351
438 Ga0157375_10643790 3300013308 Bacteria 1217
439 Ga0157375_10761348 3300013308 Bacteria 1119
440 Ga0157375_11386926 3300013308 Bacteria 828
441 Ga0157375_11488687 3300013308 Unclassified 799
442 Ga0163163_10001943 3300014325 Bacteria 17483
443 Ga0163163_10028546 3300014325 Bacteria 5360
444 Ga0163163_10135171 3300014325 Bacteria 2507
445 Ga0163163_10194890 3300014325 Bacteria 2074
446 Ga0163163_11517234 3300014325 Bacteria 731
447 Ga0163163_12855245 3300014325 Bacteria 539
448 Ga0157380_10061710 3300014326 Bacteria 3000
449 Ga0157380_10133702 3300014326 Bacteria 2120
450 Ga0157380_10799357 3300014326 Bacteria 960
451 Ga0157380_11681799 3300014326 Bacteria 692
452 Ga0157377_10227125 3300014745 Bacteria 1198
453 Ga0157377_11472668 3300014745 Bacteria 540
454 Ga0157379_10004613 3300014968 Bacteria 11821
455 Ga0157379_10011275 3300014968 Bacteria 7790
456 Ga0157379_10011447 3300014968 Bacteria 7742
457 Ga0157379_10024000 3300014968 Bacteria 5412
458 Ga0157379_10053424 3300014968 Bacteria 3608
459 Ga0157379_10273397 3300014968 Unclassified 1536
460 Ga0157379_10602967 3300014968 Bacteria 1025
461 Ga0157379_10687145 3300014968 Bacteria 960
462 Ga0157379_10874003 3300014968 Bacteria 852
463 Ga0157376_10002136 3300014969 Bacteria 13315
464 Ga0157376_10004217 3300014969 Bacteria 9973
465 Ga0157376_10039108 3300014969 Bacteria 3865
466 Ga0157376_10191046 3300014969 Bacteria 1878
467 Ga0157376_10523424 3300014969 Bacteria 1169
468 Ga0157376_10558642 3300014969 Bacteria 1134
469 Ga0157376_10616598 3300014969 Bacteria 1082
470 Ga0163161_10010575 3300017792 Bacteria 6390
471 Ga0163161_10082833 3300017792 Bacteria 2364
472 Ga0163161_10083911 3300017792 Bacteria 2349
473 Ga0163161_10138470 3300017792 Bacteria 1841
474 Ga0163161_11093640 3300017792 Bacteria 685
475 Ga0163161_11099519 3300017792 Bacteria 683
476 Ga0207666_1010676 3300025271 Bacteria 1260
477 Ga0207697_10000360 3300025315 Bacteria 25437
478 Ga0207697_10012962 3300025315 Bacteria 3484
479 Ga0207697_10165818 3300025315 Bacteria 965
480 Ga0207656_10072956 3300025321 Bacteria 1529
481 Ga0207656_10077866 3300025321 Bacteria 1485
482 Ga0207656_10396560 3300025321 Bacteria 693
483 Ga0207656_10501857 3300025321 Unclassified 616
484 Ga0207682_10006100 3300025893 Bacteria 4872
485 Ga0207682_10134788 3300025893 Bacteria 1104
486 Ga0207682_10280911 3300025893 Unclassified 778
487 Ga0207692_10041023 3300025898 Bacteria 2288
488 Ga0207642_10004984 3300025899 Bacteria 4306
489 Ga0207642_10148156 3300025899 Bacteria 1246
490 Ga0207642_10882496 3300025899 Unclassified 572
491 Ga0207710_10179851 3300025900 Bacteria 1037
492 Ga0207710_10273280 3300025900 Bacteria 849
493 Ga0207688_10079044 3300025901 Bacteria 1875
494 Ga0207688_10381353 3300025901 Bacteria 872
495 Ga0207688_10729167 3300025901 Unclassified 627
496 Ga0207680_10001960 3300025903 Bacteria 9641
497 Ga0207680_10011322 3300025903 Bacteria 4503
498 Ga0207680_10024743 3300025903 Bacteria 3300
499 Ga0207680_10069997 3300025903 Bacteria 2170
500 Ga0207680_10076553 3300025903 Bacteria 2090
501 Ga0207680_10152097 3300025903 Unclassified 1544
502 Ga0207680_11203350 3300025903 Bacteria 540
503 Ga0207647_10129115 3300025904 Bacteria 1486
504 Ga0207647_10497031 3300025904 Unclassified 680
505 Ga0207645_10022522 3300025907 Bacteria 4097
506 Ga0207645_10024272 3300025907 Bacteria 3933
507 Ga0207645_10027029 3300025907 Bacteria 3708
508 Ga0207645_10150011 3300025907 Bacteria 1521
509 Ga0207645_10209244 3300025907 Bacteria 1284
510 Ga0207645_10277866 3300025907 Bacteria 1112
511 Ga0207643_10006062 3300025908 Bacteria 6460
512 Ga0207643_10011788 3300025908 Bacteria 4718
513 Ga0207643_10017612 3300025908 Bacteria 3908
514 Ga0207643_10018035 3300025908 Bacteria 3866
515 Ga0207643_10650212 3300025908 Bacteria 680
516 Ga0207643_10806051 3300025908 Bacteria 608
517 Ga0207705_10058870 3300025909 Bacteria 2771
518 Ga0207705_10359524 3300025909 Bacteria 1123
519 Ga0207654_10007902 3300025911 Bacteria 5362
520 Ga0207707_10041527 3300025912 Bacteria 4017
521 Ga0207707_11453933 3300025912 Bacteria 545
522 Ga0207671_10393320 3300025914 Bacteria 1102
523 Ga0207671_10814567 3300025914 Bacteria 740
524 Ga0207671_11306083 3300025914 Bacteria 565
525 Ga0207693_10002204 3300025915 Bacteria 16993
526 Ga0207693_10276293 3300025915 Bacteria 1316
527 Ga0207663_10018661 3300025916 Bacteria 3893
528 Ga0207663_10383846 3300025916 Bacteria 1071
529 Ga0207662_10395810 3300025918 Unclassified 936
530 Ga0207657_10000596 3300025919 Bacteria 38318
531 Ga0207657_10042319 3300025919 Bacteria 4020
532 Ga0207657_10060294 3300025919 Bacteria 3256
533 Ga0207657_10113335 3300025919 Bacteria 2237
534 Ga0207649_10001393 3300025920 Bacteria 14316
535 Ga0207652_10525832 3300025921 Unclassified 1064
536 Ga0207681_10004955 3300025923 Bacteria 8180
537 Ga0207681_10504516 3300025923 Bacteria 991
538 Ga0207681_10719268 3300025923 Bacteria 831
539 Ga0207681_10835062 3300025923 Bacteria 770
540 Ga0207681_10973829 3300025923 Bacteria 711
541 Ga0207694_10323403 3300025924 Bacteria 1273
542 Ga0207694_10802692 3300025924 Bacteria 795
543 Ga0207650_10022832 3300025925 Bacteria 4433
544 Ga0207650_10030308 3300025925 Bacteria 3895
545 Ga0207650_10044602 3300025925 Bacteria 3259
546 Ga0207650_10137026 3300025925 Bacteria 1921
547 Ga0207650_10222499 3300025925 Unclassified 1520
548 Ga0207650_10253672 3300025925 Bacteria 1425
549 Ga0207650_10325641 3300025925 Bacteria 1259
550 Ga0207650_10395882 3300025925 Bacteria 1143
551 Ga0207650_10485655 3300025925 Bacteria 1031
552 Ga0207650_10523885 3300025925 Bacteria 992
553 Ga0207650_10669006 3300025925 Bacteria 876
554 Ga0207659_10000750 3300025926 Bacteria 19212
555 Ga0207659_10017962 3300025926 Bacteria 4629
556 Ga0207659_10021441 3300025926 Bacteria 4288
557 Ga0207659_10021592 3300025926 Bacteria 4276
558 Ga0207659_10176594 3300025926 Bacteria 1689
559 Ga0207659_10195609 3300025926 Bacteria 1611
560 Ga0207659_10376502 3300025926 Bacteria 1183
561 Ga0207687_10000381 3300025927 Bacteria 29858
562 Ga0207687_10020446 3300025927 Bacteria 4391
563 Ga0207687_10055595 3300025927 Bacteria 2774
564 Ga0207700_10000303 3300025928 Bacteria 29240
565 Ga0207700_10146088 3300025928 Bacteria 1949
566 Ga0207644_10003494 3300025931 Bacteria 10167
567 Ga0207644_10004203 3300025931 Bacteria 9342
568 Ga0207644_10013329 3300025931 Bacteria 5478
569 Ga0207644_10040410 3300025931 Bacteria 3296
570 Ga0207644_10043326 3300025931 Bacteria 3193
571 Ga0207644_10051698 3300025931 Bacteria 2950
572 Ga0207644_10149666 3300025931 Bacteria 1805
573 Ga0207644_10152334 3300025931 Bacteria 1790
574 Ga0207644_10162762 3300025931 Bacteria 1735
575 Ga0207644_10179914 3300025931 Bacteria 1656
576 Ga0207644_10190264 3300025931 Bacteria 1613
577 Ga0207644_10196513 3300025931 Bacteria 1589
578 Ga0207644_10452945 3300025931 Bacteria 1054
579 Ga0207644_10673382 3300025931 Bacteria 862
580 Ga0207644_10734846 3300025931 Bacteria 824
581 Ga0207644_11035642 3300025931 Bacteria 689
582 Ga0207690_10000419 3300025932 Bacteria 27647
583 Ga0207690_10323517 3300025932 Bacteria 1213
584 Ga0207706_10000074 3300025933 Bacteria 103144
585 Ga0207706_10012830 3300025933 Bacteria 7628
586 Ga0207706_10069845 3300025933 Unclassified 3089
587 Ga0207706_10306462 3300025933 Bacteria 1383
588 Ga0207706_10319531 3300025933 Bacteria 1351
589 Ga0207706_11274783 3300025933 Bacteria 608
590 Ga0207686_10000089 3300025934 Bacteria 74250
591 Ga0207686_10132826 3300025934 Bacteria 1709
592 Ga0207686_10276792 3300025934 Bacteria 1237
593 Ga0207709_10658185 3300025935 Bacteria 835
594 Ga0207670_10219591 3300025936 Bacteria 1454
595 Ga0207670_10358498 3300025936 Bacteria 1156
596 Ga0207670_10411639 3300025936 Bacteria 1083
597 Ga0207670_10501179 3300025936 Bacteria 986
598 Ga0207669_10175252 3300025937 Bacteria 1531
599 Ga0207669_10198113 3300025937 Bacteria 1455
600 Ga0207669_10228757 3300025937 Bacteria 1370
601 Ga0207669_10390155 3300025937 Bacteria 1087
602 Ga0207669_10572345 3300025937 Bacteria 914
603 Ga0207669_10692447 3300025937 Unclassified 837
604 Ga0207669_10775292 3300025937 Bacteria 793
605 Ga0207669_10947591 3300025937 Bacteria 721
606 Ga0207704_10213654 3300025938 Bacteria 1422
607 Ga0207704_10229411 3300025938 Bacteria 1380
608 Ga0207704_10239130 3300025938 Bacteria 1355
609 Ga0207704_10309366 3300025938 Bacteria 1214
610 Ga0207704_10320150 3300025938 Bacteria 1196
611 Ga0207665_10001668 3300025939 Bacteria 14938
612 Ga0207691_10000343 3300025940 Bacteria 46843
613 Ga0207691_10018378 3300025940 Bacteria 6623
614 Ga0207691_10030841 3300025940 Bacteria 5007
615 Ga0207691_10054949 3300025940 Bacteria 3631
616 Ga0207691_10093361 3300025940 Bacteria 2695
617 Ga0207691_10131497 3300025940 Bacteria 2210
618 Ga0207691_10192694 3300025940 Bacteria 1777
619 Ga0207691_10216759 3300025940 Bacteria 1661
620 Ga0207691_10624745 3300025940 Bacteria 911
621 Ga0207691_11574803 3300025940 Bacteria 535
622 Ga0207711_10002413 3300025941 Bacteria 16687
623 Ga0207711_10055864 3300025941 Bacteria 3391
624 Ga0207711_10064314 3300025941 Bacteria 3168
625 Ga0207711_10198666 3300025941 Bacteria 1829
626 Ga0207711_10522161 3300025941 Bacteria 1107
627 Ga0207711_10709991 3300025941 Bacteria 938
628 Ga0207689_10004467 3300025942 Bacteria 12685
629 Ga0207689_10008702 3300025942 Bacteria 8833
630 Ga0207689_10024071 3300025942 Bacteria 5108
631 Ga0207689_10025220 3300025942 Bacteria 4984
632 Ga0207689_10077292 3300025942 Bacteria 2736
633 Ga0207679_10003143 3300025945 Bacteria 10198
634 Ga0207679_10046304 3300025945 Bacteria 3152
635 Ga0207679_10650159 3300025945 Bacteria 954
636 Ga0207667_10006831 3300025949 Bacteria 13791
637 Ga0207667_10109436 3300025949 Bacteria 2850
638 Ga0207667_10190913 3300025949 Bacteria 2102
639 Ga0207667_10504309 3300025949 Bacteria 1227
640 Ga0207667_10918522 3300025949 Bacteria 866
641 Ga0207651_10005850 3300025960 Bacteria 6358
642 Ga0207651_10009370 3300025960 Bacteria 5356
643 Ga0207651_10026315 3300025960 Bacteria 3631
644 Ga0207651_10069535 3300025960 Bacteria 2486
645 Ga0207651_10070333 3300025960 Bacteria 2475
646 Ga0207651_10597306 3300025960 Bacteria 964
647 Ga0207651_10864787 3300025960 Bacteria 804
648 Ga0207712_10088653 3300025961 Bacteria 2272
649 Ga0207712_10123871 3300025961 Bacteria 1960
650 Ga0207668_10002613 3300025972 Bacteria 10534
651 Ga0207668_10038434 3300025972 Bacteria 3212
652 Ga0207668_10045441 3300025972 Bacteria 2995
653 Ga0207668_10062619 3300025972 Bacteria 2620
654 Ga0207668_10115067 3300025972 Bacteria 2025
655 Ga0207668_10203527 3300025972 Bacteria 1578
656 Ga0207668_10236172 3300025972 Bacteria 1476
657 Ga0207668_10346068 3300025972 Bacteria 1241
658 Ga0207668_11024298 3300025972 Bacteria 738
659 Ga0207668_11106839 3300025972 Bacteria 710
660 Ga0207640_10007051 3300025981 Bacteria 6188
661 Ga0207640_10036600 3300025981 Bacteria 3083
662 Ga0207640_10165360 3300025981 Bacteria 1642
663 Ga0207658_10010282 3300025986 Bacteria 6358
664 Ga0207658_10029445 3300025986 Bacteria 3878
665 Ga0207658_10071981 3300025986 Bacteria 2619
666 Ga0207658_10093532 3300025986 Bacteria 2337
667 Ga0207658_10103919 3300025986 Bacteria 2231
668 Ga0207658_10127466 3300025986 Bacteria 2039
669 Ga0207658_10191158 3300025986 Bacteria 1702
670 Ga0207658_10370637 3300025986 Unclassified 1252
671 Ga0207658_10456201 3300025986 Bacteria 1132
672 Ga0207658_10572794 3300025986 Bacteria 1012
673 Ga0207677_10000334 3300026023 Bacteria 33917
674 Ga0207677_10021801 3300026023 Bacteria 3923
675 Ga0207677_10122641 3300026023 Bacteria 1958
676 Ga0207677_10332118 3300026023 Bacteria 1267
677 Ga0207677_10699640 3300026023 Bacteria 899
678 Ga0207677_11031836 3300026023 Bacteria 747
679 Ga0207703_10002343 3300026035 Bacteria 16514
680 Ga0207703_10004134 3300026035 Bacteria 11968
681 Ga0207703_10005461 3300026035 Bacteria 10223
682 Ga0207703_10746326 3300026035 Bacteria 932
683 Ga0207703_10833796 3300026035 Bacteria 881
684 Ga0207639_10004171 3300026041 Bacteria 9729
685 Ga0207639_10111377 3300026041 Bacteria 2231
686 Ga0207639_10224931 3300026041 Bacteria 1623
687 Ga0207639_10479882 3300026041 Bacteria 1133
688 Ga0207639_10885937 3300026041 Bacteria 834
689 Ga0207678_10021501 3300026067 Bacteria 5657
690 Ga0207678_10060942 3300026067 Bacteria 3245
691 Ga0207678_10126372 3300026067 Bacteria 2181
692 Ga0207678_10971764 3300026067 Bacteria 751
693 Ga0207708_10033311 3300026075 Bacteria 3914
694 Ga0207708_10143147 3300026075 Bacteria 1877
695 Ga0207708_10407846 3300026075 Bacteria 1125
696 Ga0207708_10594819 3300026075 Bacteria 937
697 Ga0207702_10001999 3300026078 Bacteria 19779
698 Ga0207702_10164898 3300026078 Bacteria 2026
699 Ga0207641_10002499 3300026088 Bacteria 16966
700 Ga0207641_10054673 3300026088 Bacteria 3388
701 Ga0207641_10244707 3300026088 Bacteria 1673
702 Ga0207641_10314749 3300026088 Bacteria 1482
703 Ga0207641_10376153 3300026088 Bacteria 1359
704 Ga0207641_10714416 3300026088 Bacteria 987
705 Ga0207641_10729078 3300026088 Bacteria 977
706 Ga0207648_10001061 3300026089 Bacteria 30777
707 Ga0207648_10006527 3300026089 Bacteria 11577
708 Ga0207648_10027228 3300026089 Bacteria 5077
709 Ga0207648_10198501 3300026089 Bacteria 1779
710 Ga0207648_10399545 3300026089 Bacteria 1245
711 Ga0207648_10406436 3300026089 Bacteria 1234
712 Ga0207648_10463385 3300026089 Bacteria 1155
713 Ga0207648_11265930 3300026089 Unclassified 693
714 Ga0207676_10000507 3300026095 Bacteria 32853
715 Ga0207676_10003627 3300026095 Bacteria 10919
716 Ga0207676_10056161 3300026095 Bacteria 3094
717 Ga0207676_10072191 3300026095 Bacteria 2773
718 Ga0207676_10335135 3300026095 Bacteria 1394
719 Ga0207676_10737223 3300026095 Bacteria 957
720 Ga0207674_10069424 3300026116 Bacteria 3544
721 Ga0207674_10839452 3300026116 Bacteria 886
722 Ga0207675_100027260 3300026118 Bacteria 5322
723 Ga0207675_100060906 3300026118 Bacteria 3524
724 Ga0207675_100204091 3300026118 Bacteria 1899
725 Ga0207675_100263381 3300026118 Bacteria 1671
726 Ga0207675_100316664 3300026118 Bacteria 1522
727 Ga0207675_100376927 3300026118 Bacteria 1394
728 Ga0207675_100412582 3300026118 Bacteria 1333
729 Ga0207675_100424741 3300026118 Bacteria 1313
730 Ga0207675_100524367 3300026118 Bacteria 1181
731 Ga0207675_101373885 3300026118 Bacteria 727
732 Ga0207675_102048160 3300026118 Bacteria 589
733 Ga0207675_102608489 3300026118 Unclassified 515
734 Ga0207683_10000182 3300026121 Bacteria 54134
735 Ga0207683_10000354 3300026121 Bacteria 42027
736 Ga0207683_10013325 3300026121 Bacteria 7010
737 Ga0207683_10073734 3300026121 Bacteria 3019
738 Ga0207683_10187210 3300026121 Bacteria 1878
739 Ga0207683_10215763 3300026121 Bacteria 1747
740 Ga0207683_10417759 3300026121 Bacteria 1235
741 Ga0207683_10608062 3300026121 Unclassified 1012
742 Ga0207698_10053904 3300026142 Bacteria 3091
743 Ga0207698_10408943 3300026142 Bacteria 1299
744 Ga0207698_10857715 3300026142 Bacteria 913
745 Ga0207698_12022826 3300026142 Unclassified 590
746 Ga0207428_10169034 3300027907 Bacteria 1657
747 Ga0268266_10032930 3300028379 Bacteria 4405
748 Ga0268266_10040992 3300028379 Bacteria 3948
749 Ga0268266_10143050 3300028379 Bacteria 2148
750 Ga0268266_10206360 3300028379 Bacteria 1800
751 Ga0268266_10889454 3300028379 Bacteria 861
752 Ga0268265_10028746 3300028380 Bacteria 3984
753 Ga0268265_10029037 3300028380 Bacteria 3966
754 Ga0268265_10049388 3300028380 Bacteria 3164
755 Ga0268265_10199338 3300028380 Bacteria 1735
756 Ga0268265_10203032 3300028380 Bacteria 1721
757 Ga0268265_11110899 3300028380 Bacteria 785
758 Ga0268265_11691714 3300028380 Bacteria 638
759 Ga0268265_11807600 3300028380 Bacteria 617
760 Ga0268264_10017649 3300028381 Bacteria 5843
761 Ga0268264_10024915 3300028381 Bacteria 4889
762 Ga0268264_10033683 3300028381 Bacteria 4211
763 Ga0268264_10211851 3300028381 Bacteria 1779
764 Ga0268264_10467640 3300028381 Bacteria 1224
765 Ga0268264_10809920 3300028381 Bacteria 936
766 Ga0268264_10916539 3300028381 Bacteria 880
767 Ga0268264_11086251 3300028381 Bacteria 808
768 Ga0268264_12648363 3300028381 Unclassified 506
769 Ga0307410_10293814 3300031852 Bacteria 1280
770 Ga0373926_0106288 3300035083 Bacteria 1052
771 Ga0373928_0064487 3300035084 Bacteria 893
772 Ga0373929_0087617 3300035085 Bacteria 768
773 Ga0373934_0023910 3300035086 Bacteria 2362
774 Ga0373934_0123104 3300035086 Bacteria 1055
775 Ga0373949_0147588 3300035090 Bacteria 678
776 Ga0373949_0166815 3300035090 Unclassified 645
777 Ga0373936_0187313 3300035113 Bacteria 910
778 Ga0373936_0357822 3300035113 Bacteria 665
779 Ga0373945_0006562 3300035116 Bacteria 3760
780 Ga0373945_0048460 3300035116 Bacteria 1556
781 Ga0373953_0102572 3300035117 Bacteria 1205
782 Ga0373954_0003857 3300035118 Bacteria 6414
783 Ga0373954_0022524 3300035118 Bacteria 2859
784 Ga0373954_0062021 3300035118 Bacteria 1766
785 Ga0373956_0006805 3300035119 Bacteria 4586
786 Ga0373956_0144215 3300035119 Bacteria 1119
787 Ga0373956_0159857 3300035119 Bacteria 1061
788 Ga0373957_0016834 3300035120 Bacteria 2537
789 Ga0373957_0058166 3300035120 Bacteria 1493
790 Ga0373957_0193475 3300035120 Bacteria 846
791 Ga0373943_0009086 3300035170 Bacteria 4454
792 Ga0373943_0010835 3300035170 Bacteria 4092
793 Ga0373943_0149775 3300035170 Bacteria 1263
794 Ga0373946_0145370 3300035171 Bacteria 1102
795 Ga0373955_0019009 3300035172 Bacteria 3426
796 Ga0373955_0186437 3300035172 Bacteria 1232
797 Ga0373924_0001116 3300035410 Bacteria 8607
798 Ga0373924_0010622 3300035410 Bacteria 3403
799 Ga0373935_0017451 3300035692 Bacteria 4355
800 Ga0373935_0958167 3300035692 Bacteria 635
801 Ga0373927_0005157 3300035695 Bacteria 9035
802 Ga0373927_0060209 3300035695 Bacteria 2456
803 Ga0373933_0111566 3300035724 Bacteria 1706
804 Ga0373947_0009444 3300035725 Bacteria 5600
805 Ga0373937_0050298 3300036401 Bacteria 3817
806 Ga0373937_0227890 3300036401 Bacteria 1754
807 Ga0373937_0707513 3300036401 Bacteria 954
808 Ga0373937_0723186 3300036401 Bacteria 942
809 Ga0373937_1334621 3300036401 Bacteria 665
810 Ga0373925_0004419 3300037068 Bacteria 10622
811 Ga0373925_0027420 3300037068 Bacteria 4169
812 Ga0373925_0109280 3300037068 Bacteria 2134
813 Ga0373925_0204330 3300037068 Bacteria 1572
814 Ga0373925_0297836 3300037068 Bacteria 1302
815 Ga0451835_0380934 3300041492 Unclassified 532
816 Ga0451843_0347911 3300041509 Bacteria 715
817 Ga0451853_0075890 3300041512 Bacteria 819
818 Ga0451853_1874952 3300041512 Bacteria 740
819 Ga0453683_1120323 3300044673 Bacteria 525
820 Ga0451576_0905099 3300045051 Bacteria 926
821 Ga0495629_0004825 3300046459 Bacteria 10112
822 Ga0495629_0103059 3300046459 Bacteria 1991
823 Ga0495653_0188908 3300046463 Bacteria 1407
824 Ga0495580_0167491 3300046472 Bacteria 1519
825 Ga0495580_0680614 3300046472 Bacteria 674
826 Ga0495582_0084900 3300046473 Bacteria 1760
827 Ga0495582_0279941 3300046473 Unclassified 958
828 Ga0495639_0009426 3300046475 Bacteria 4187
829 Ga0495662_0146604 3300046476 Bacteria 1162
830 Ga0495664_0510738 3300046477 Bacteria 717
831 Ga0495594_0014259 3300046499 Bacteria 4161
832 Ga0495618_0614541 3300046514 Bacteria 646
833 Ga0495666_0049663 3300046526 Bacteria 2018
834 Ga0495665_0016597 3300046531 Bacteria 3966
835 Ga0495640_0047243 3300046533 Bacteria 2980
836 Ga0495640_0784610 3300046533 Bacteria 568
837 Ga0495586_0820120 3300046535 Bacteria 536
838 Ga0495598_0053991 3300046537 Bacteria 1219
839 Ga0495598_0087475 3300046537 Bacteria 1010
840 Ga0495621_0019081 3300046539 Bacteria 2235
841 Ga0495621_0070798 3300046539 Bacteria 1284
842 Ga0495621_0072955 3300046539 Bacteria 1268
843 Ga0495645_0009252 3300046543 Bacteria 6888
844 Ga0495645_0046403 3300046543 Bacteria 3167
845 Ga0495667_0287763 3300046559 Bacteria 1042
846 Ga0495635_0072763 3300046663 Bacteria 2354
847 Ga0495659_0006548 3300046664 Bacteria 3679
848 Ga0495588_0047383 3300046674 Bacteria 2207
849 Ga0495657_0118409 3300046675 Bacteria 1671
850 Ga0495623_0491963 3300046679 Bacteria 648
851 Ga0495647_0015961 3300046681 Bacteria 2638
852 Ga0495658_0176899 3300046683 Bacteria 1322
853 Ga0495613_0059968 3300046689 Bacteria 2787
854 Ga0495624_0308751 3300046690 Bacteria 953
855 Ga0495600_0186773 3300046809 Bacteria 1334
856 Ga0495600_0805755 3300046809 Bacteria 559
857 Ga0495581_0004194 3300047315 Bacteria 8309
858 Ga0495674_0652218 3300047319 Bacteria 830
859 Ga0495680_0002877 3300047322 Bacteria 17297
860 Ga0495675_0112977 3300047444 Bacteria 1695
861 Ga0495675_0497842 3300047444 Bacteria 700
862 Ga0495681_0290852 3300047470 Bacteria 635
863 Ga0495684_0065156 3300047471 Bacteria 2769
864 Ga0495684_0091125 3300047471 Bacteria 2309
865 Ga0495684_0376301 3300047471 Bacteria 1003
866 Ga0495593_0047848 3300047673 Bacteria 2274
867 Ga0495615_0188382 3300048090 Bacteria 632
868 Ga0496100_0695657 3300048903 Bacteria 793
869 Ga0496100_1064261 3300048903 Bacteria 637
870 Ga0496101_0088711 3300048904 Bacteria 2297
871 Ga0496102_0138801 3300048905 Bacteria 2278
872 Ga0496102_0646923 3300048905 Bacteria 980
873 Ga0496103_0066448 3300048906 Bacteria 2251
874 Ga0496103_0102089 3300048906 Bacteria 1816
875 Ga0496104_0008572 3300048907 Bacteria 9093
876 Ga0496105_0058419 3300048908 Bacteria 3184
877 Ga0496105_0415100 3300048908 Bacteria 1066
878 Ga0496106_0001506 3300048909 Bacteria 17507
879 Ga0496106_0147370 3300048909 Bacteria 1855
880 Ga0496106_0187832 3300048909 Bacteria 1642
881 Ga0496106_0347346 3300048909 Bacteria 1192
882 Ga0496106_0366717 3300048909 Bacteria 1157
883 Ga0496106_1093438 3300048909 Bacteria 625
884 Ga0496107_0020879 3300048910 Bacteria 4629
885 Ga0496107_0023453 3300048910 Bacteria 4363
886 Ga0496107_0386393 3300048910 Bacteria 1041
887 Ga0496107_0835605 3300048910 Bacteria 673
888 Ga0496108_0336445 3300048911 Bacteria 1317
889 Ga0496108_0657190 3300048911 Bacteria 911
890 Ga0496108_0976297 3300048911 Bacteria 724
891 Ga0496109_0021470 3300048912 Bacteria 5709
892 Ga0496109_0037027 3300048912 Unclassified 4407
893 Ga0496109_0055578 3300048912 Bacteria 3612
894 Ga0496109_0172880 3300048912 Bacteria 2027
895 Ga0496109_0380919 3300048912 Bacteria 1333
896 Ga0496109_0756918 3300048912 Bacteria 909
897 Ga0496109_1753815 3300048912 Unclassified 554
898 Ga0496110_0036433 3300048913 Bacteria 4272
899 Ga0496110_0186820 3300048913 Bacteria 1882
900 Ga0496110_1192098 3300048913 Unclassified 670
901 Ga0496111_0028854 3300048914 Bacteria 3935
902 Ga0496111_0696137 3300048914 Bacteria 739
903 Ga0496112_0001106 3300048915 Bacteria 19989
904 Ga0496112_1193646 3300048915 Bacteria 678
905 Ga0496113_0150584 3300048916 Bacteria 1835
906 Ga0496113_0318797 3300048916 Bacteria 1246
907 Ga0496113_1421377 3300048916 Bacteria 537
908 Ga0496114_0022176 3300048917 Bacteria 5173
909 Ga0496114_0525989 3300048917 Bacteria 1046
910 Ga0496114_1165159 3300048917 Unclassified 656
911 Ga0496115_0096204 3300048918 Bacteria 2424
912 Ga0496115_1097740 3300048918 Bacteria 603
913 Ga0501042_0371809 3300049578 Bacteria 1035
914 Ga0501072_0209680 3300049588 Bacteria 1553
915 Ga0501077_0709302 3300049593 Unclassified 647
916 nmdc:mga08y16_240342_c1 3300050511 Bacteria 1872
917 nmdc:mga08y16_754503_c1 3300050511 Bacteria 969
918 nmdc:mga0n895_1042603_c1 3300050512 Bacteria 797
919 nmdc:mga0rr50_643620_c1 3300050513 Bacteria 904
920 Ga0495601_0230047 3300053077 Bacteria 1211
921 Ga0495595_0225165 3300053084 Bacteria 936
922 Ga0495619_0086415 3300053085 Bacteria 2120
923 Ga0495619_0093105 3300053085 Bacteria 2042

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0204330 Ga0373925_0204330_1026_1415 116
2 3300005615 Ga0070702_101304457 Ga0070702_1013044571 117
3 3300035119 Ga0373956_0144215 Ga0373956_0144215_718_1101 117
4 3300035172 Ga0373955_0186437 Ga0373955_0186437_50_433 117
5 3300046539 Ga0495621_0070798 Ga0495621_0070798_41_424 119
6 3300035120 Ga0373957_0058166 Ga0373957_0058166_438_863 121
7 3300036401 Ga0373937_0050298 Ga0373937_0050298_2966_3391 121
8 3300002075 JGI24738J21930_10038243 JGI24738J21930_100382432 122
9 3300005293 Ga0065715_10130541 Ga0065715_101305412 122
10 3300005328 Ga0070676_10018765 Ga0070676_100187653 122
11 3300005337 Ga0070682_100725287 Ga0070682_1007252872 122
12 3300005344 Ga0070661_100001085 Ga0070661_10000108512 122
13 3300005347 Ga0070668_101896924 Ga0070668_1018969241 122
14 3300005354 Ga0070675_100039515 Ga0070675_1000395153 122
15 3300005355 Ga0070671_100001994 Ga0070671_1000019946 122
16 3300005364 Ga0070673_100029371 Ga0070673_1000293712 122
17 3300005366 Ga0070659_100007565 Ga0070659_1000075655 122
18 3300005441 Ga0070700_101008293 Ga0070700_1010082931 122
19 3300005455 Ga0070663_100452734 Ga0070663_1004527342 122
20 3300005456 Ga0070678_100170102 Ga0070678_1001701022 122
21 3300005457 Ga0070662_100000248 Ga0070662_10000024812 122
22 3300005459 Ga0068867_100016598 Ga0068867_1000165984 122
23 3300005530 Ga0070679_101745310 Ga0070679_1017453101 122
24 3300005539 Ga0068853_100004274 Ga0068853_1000042746 122
25 3300005543 Ga0070672_100005788 Ga0070672_1000057887 122
26 3300005563 Ga0068855_100001259 Ga0068855_10000125915 122
27 3300005564 Ga0070664_100005493 Ga0070664_1000054939 122
28 3300005578 Ga0068854_100040078 Ga0068854_1000400783 122
29 3300005614 Ga0068856_100000181 Ga0068856_10000018128 122
30 3300005616 Ga0068852_101087464 Ga0068852_1010874642 122
31 3300005834 Ga0068851_10874127 Ga0068851_108741272 122
32 3300005841 Ga0068863_102358865 Ga0068863_1023588651 122
33 3300006358 Ga0068871_100257370 Ga0068871_1002573702 122
34 3300014968 Ga0157379_10053424 Ga0157379_100534243 122
35 3300025321 Ga0207656_10501857 Ga0207656_105018571 122
36 3300025901 Ga0207688_10729167 Ga0207688_107291672 122
37 3300025903 Ga0207680_11203350 Ga0207680_112033501 122
38 3300025904 Ga0207647_10497031 Ga0207647_104970312 122
39 3300025912 Ga0207707_11453933 Ga0207707_114539332 122
40 3300025919 Ga0207657_10000596 Ga0207657_1000059618 122
41 3300025920 Ga0207649_10001393 Ga0207649_100013935 122
42 3300025931 Ga0207644_10003494 Ga0207644_100034947 122
43 3300025932 Ga0207690_10000419 Ga0207690_1000041912 122
44 3300025933 Ga0207706_10000074 Ga0207706_1000007429 122
45 3300025940 Ga0207691_10131497 Ga0207691_101314973 122
46 3300025945 Ga0207679_10003143 Ga0207679_100031439 122
47 3300025949 Ga0207667_10006831 Ga0207667_100068319 122
48 3300025960 Ga0207651_10069535 Ga0207651_100695353 122
49 3300025981 Ga0207640_10036600 Ga0207640_100366004 122
50 3300026041 Ga0207639_10004171 Ga0207639_100041714 122
51 3300026078 Ga0207702_10001999 Ga0207702_100019995 122
52 3300026121 Ga0207683_10187210 Ga0207683_101872102 122
53 3300035084 Ga0373928_0064487 Ga0373928_0064487_287_691 122
54 3300035090 Ga0373949_0166815 Ga0373949_0166815_24_428 122
55 3300041512 Ga0451853_0075890 Ga0451853_0075890_277_723 122
56 3300048905 Ga0496102_0138801 Ga0496102_0138801_649_1053 122
57 3300048906 Ga0496103_0102089 Ga0496103_0102089_331_735 122
58 3300048909 Ga0496106_0001506 Ga0496106_0001506_3484_3888 122
59 3300048910 Ga0496107_0020879 Ga0496107_0020879_2520_2924 122
60 3300048913 Ga0496110_1192098 Ga0496110_1192098_256_660 122
61 3300006871 Ga0075434_100416213 Ga0075434_1004162132 123
62 3300017792 Ga0163161_10010575 Ga0163161_100105753 123
63 3300025899 Ga0207642_10148156 Ga0207642_101481562 123
64 3300025934 Ga0207686_10132826 Ga0207686_101328262 123
65 3300025937 Ga0207669_10175252 Ga0207669_101752522 123
66 3300025938 Ga0207704_10213654 Ga0207704_102136542 123
67 3300025986 Ga0207658_10191158 Ga0207658_101911582 123
68 3300026067 Ga0207678_10060942 Ga0207678_100609423 123
69 3300026089 Ga0207648_10006527 Ga0207648_100065274 123
70 3300026121 Ga0207683_10013325 Ga0207683_100133255 123
71 3300005331 Ga0070670_101004107 Ga0070670_1010041071 126
72 3300005335 Ga0070666_10508297 Ga0070666_105082971 126
73 3300005340 Ga0070689_100577174 Ga0070689_1005771742 126
74 3300005347 Ga0070668_100000374 Ga0070668_1000003744 126
75 3300005347 Ga0070668_100544472 Ga0070668_1005444722 126
76 3300005353 Ga0070669_100394079 Ga0070669_1003940792 126
77 3300005354 Ga0070675_100004304 Ga0070675_1000043046 126
78 3300005355 Ga0070671_100271107 Ga0070671_1002711072 126
79 3300005356 Ga0070674_100155617 Ga0070674_1001556172 126
80 3300005356 Ga0070674_100658750 Ga0070674_1006587502 126
81 3300005439 Ga0070711_101073288 Ga0070711_1010732881 126
82 3300005543 Ga0070672_100481411 Ga0070672_1004814112 126
83 3300005548 Ga0070665_100551585 Ga0070665_1005515852 126
84 3300005618 Ga0068864_101177177 Ga0068864_1011771771 126
85 3300005719 Ga0068861_100249845 Ga0068861_1002498452 126
86 3300005719 Ga0068861_100558031 Ga0068861_1005580312 126
87 3300005844 Ga0068862_100178845 Ga0068862_1001788452 126
88 3300009094 Ga0111539_10306782 Ga0111539_103067822 126
89 3300009177 Ga0105248_10982603 Ga0105248_109826032 126
90 3300025893 Ga0207682_10134788 Ga0207682_101347882 126
91 3300025908 Ga0207643_10650212 Ga0207643_106502122 126
92 3300025926 Ga0207659_10021441 Ga0207659_100214413 126
93 3300025931 Ga0207644_10190264 Ga0207644_101902642 126
94 3300025936 Ga0207670_10358498 Ga0207670_103584982 126
95 3300025937 Ga0207669_10572345 Ga0207669_105723452 126
96 3300025940 Ga0207691_10192694 Ga0207691_101926942 126
97 3300025941 Ga0207711_10709991 Ga0207711_107099912 126
98 3300025972 Ga0207668_10002613 Ga0207668_100026132 126
99 3300025972 Ga0207668_10045441 Ga0207668_100454413 126
100 3300025986 Ga0207658_10572794 Ga0207658_105727941 126
101 3300026035 Ga0207703_10833796 Ga0207703_108337962 126
102 3300026089 Ga0207648_10463385 Ga0207648_104633852 126
103 3300026118 Ga0207675_100524367 Ga0207675_1005243672 126
104 3300028379 Ga0268266_10889454 Ga0268266_108894542 126
105 3300028380 Ga0268265_10199338 Ga0268265_101993382 126
106 3300035410 Ga0373924_0001116 Ga0373924_0001116_5198_5596 126
107 3300041492 Ga0451835_0380934 Ga0451835_0380934_28_474 126
108 3300048917 Ga0496114_1165159 Ga0496114_1165159_132_578 126
109 3300050511 nmdc:mga08y16_754503_c1 nmdc:mga08y16_754503_c1_336_722 126
110 3300025921 Ga0207652_10525832 Ga0207652_105258322 127
111 3300025907 Ga0207645_10277866 Ga0207645_102778662 128
112 3300005328 Ga0070676_10006276 Ga0070676_100062762 129
113 3300005331 Ga0070670_100001678 Ga0070670_1000016783 129
114 3300005331 Ga0070670_100872860 Ga0070670_1008728602 129
115 3300005333 Ga0070677_10641973 Ga0070677_106419731 129
116 3300005335 Ga0070666_10002296 Ga0070666_1000229611 129
117 3300005338 Ga0068868_100038068 Ga0068868_1000380684 129
118 3300005340 Ga0070689_100431279 Ga0070689_1004312792 129
119 3300005347 Ga0070668_100047142 Ga0070668_1000471423 129
120 3300005353 Ga0070669_100092795 Ga0070669_1000927952 129
121 3300005353 Ga0070669_100284732 Ga0070669_1002847322 129
122 3300005354 Ga0070675_100003331 Ga0070675_10000333113 129
123 3300005354 Ga0070675_100792360 Ga0070675_1007923602 129
124 3300005354 Ga0070675_100882104 Ga0070675_1008821042 129
125 3300005355 Ga0070671_100041455 Ga0070671_1000414552 129
126 3300005355 Ga0070671_100103944 Ga0070671_1001039442 129
127 3300005364 Ga0070673_100042033 Ga0070673_1000420332 129
128 3300005364 Ga0070673_100612393 Ga0070673_1006123932 129
129 3300005365 Ga0070688_100323661 Ga0070688_1003236612 129
130 3300005367 Ga0070667_100102223 Ga0070667_1001022232 129
131 3300005367 Ga0070667_100254525 Ga0070667_1002545252 129
132 3300005456 Ga0070678_100045678 Ga0070678_1000456783 129
133 3300005459 Ga0068867_100147138 Ga0068867_1001471382 129
134 3300005466 Ga0070685_11049051 Ga0070685_110490512 129
135 3300005539 Ga0068853_100154067 Ga0068853_1001540672 129
136 3300005539 Ga0068853_100377202 Ga0068853_1003772022 129
137 3300005543 Ga0070672_100002393 Ga0070672_1000023933 129
138 3300005548 Ga0070665_100018631 Ga0070665_1000186316 129
139 3300005564 Ga0070664_100160027 Ga0070664_1001600272 129
140 3300005617 Ga0068859_100042909 Ga0068859_1000429093 129
141 3300005618 Ga0068864_100012219 Ga0068864_1000122194 129
142 3300005618 Ga0068864_101906473 Ga0068864_1019064732 129
143 3300005718 Ga0068866_10215490 Ga0068866_102154901 129
144 3300005719 Ga0068861_100251229 Ga0068861_1002512292 129
145 3300005840 Ga0068870_10553142 Ga0068870_105531422 129
146 3300005841 Ga0068863_100004758 Ga0068863_1000047589 129
147 3300005841 Ga0068863_100132790 Ga0068863_1001327902 129
148 3300005842 Ga0068858_100014857 Ga0068858_1000148572 129
149 3300005843 Ga0068860_100179498 Ga0068860_1001794982 129
150 3300005843 Ga0068860_102051919 Ga0068860_1020519191 129
151 3300006237 Ga0097621_100001216 Ga0097621_10000121613 129
152 3300006237 Ga0097621_100761764 Ga0097621_1007617642 129
153 3300006358 Ga0068871_100041708 Ga0068871_1000417083 129
154 3300006881 Ga0068865_100341818 Ga0068865_1003418182 129
155 3300006881 Ga0068865_101652661 Ga0068865_1016526612 129
156 3300006931 Ga0097620_100042908 Ga0097620_1000429083 129
157 3300009148 Ga0105243_10530608 Ga0105243_105306082 129
158 3300009148 Ga0105243_11347215 Ga0105243_113472152 129
159 3300009177 Ga0105248_10028146 Ga0105248_100281468 129
160 3300009177 Ga0105248_10065291 Ga0105248_100652912 129
161 3300009551 Ga0105238_10950276 Ga0105238_109502762 129
162 3300009553 Ga0105249_10141192 Ga0105249_101411923 129
163 3300009553 Ga0105249_11186480 Ga0105249_111864802 129
164 3300013296 Ga0157374_10001806 Ga0157374_100018067 129
165 3300013306 Ga0163162_10005239 Ga0163162_100052397 129
166 3300013306 Ga0163162_12178896 Ga0163162_121788961 129
167 3300013308 Ga0157375_10006814 Ga0157375_1000681410 129
168 3300013308 Ga0157375_11386926 Ga0157375_113869262 129
169 3300014325 Ga0163163_11517234 Ga0163163_115172342 129
170 3300014968 Ga0157379_10011275 Ga0157379_100112753 129
171 3300014969 Ga0157376_10002136 Ga0157376_100021364 129
172 3300014969 Ga0157376_10523424 Ga0157376_105234241 129
173 3300017792 Ga0163161_10083911 Ga0163161_100839112 129
174 3300025271 Ga0207666_1010676 Ga0207666_10106762 129
175 3300025315 Ga0207697_10012962 Ga0207697_100129623 129
176 3300025321 Ga0207656_10072956 Ga0207656_100729562 129
177 3300025893 Ga0207682_10280911 Ga0207682_102809112 129
178 3300025903 Ga0207680_10069997 Ga0207680_100699972 129
179 3300025907 Ga0207645_10022522 Ga0207645_100225223 129
180 3300025908 Ga0207643_10806051 Ga0207643_108060512 129
181 3300025923 Ga0207681_10004955 Ga0207681_100049559 129
182 3300025924 Ga0207694_10802692 Ga0207694_108026922 129
183 3300025925 Ga0207650_10044602 Ga0207650_100446022 129
184 3300025925 Ga0207650_10485655 Ga0207650_104856552 129
185 3300025926 Ga0207659_10000750 Ga0207659_1000075012 129
186 3300025926 Ga0207659_10376502 Ga0207659_103765022 129
187 3300025931 Ga0207644_10043326 Ga0207644_100433262 129
188 3300025931 Ga0207644_10152334 Ga0207644_101523342 129
189 3300025935 Ga0207709_10658185 Ga0207709_106581852 129
190 3300025936 Ga0207670_10501179 Ga0207670_105011792 129
191 3300025938 Ga0207704_10309366 Ga0207704_103093662 129
192 3300025940 Ga0207691_10000343 Ga0207691_100003437 129
193 3300025940 Ga0207691_10624745 Ga0207691_106247452 129
194 3300025941 Ga0207711_10055864 Ga0207711_100558642 129
195 3300025941 Ga0207711_10522161 Ga0207711_105221612 129
196 3300025942 Ga0207689_10008702 Ga0207689_100087022 129
197 3300025960 Ga0207651_10005850 Ga0207651_100058502 129
198 3300025961 Ga0207712_10123871 Ga0207712_101238712 129
199 3300025972 Ga0207668_10115067 Ga0207668_101150672 129
200 3300025986 Ga0207658_10010282 Ga0207658_100102826 129
201 3300026023 Ga0207677_10021801 Ga0207677_100218014 129
202 3300026035 Ga0207703_10004134 Ga0207703_1000413413 129
203 3300026041 Ga0207639_10224931 Ga0207639_102249312 129
204 3300026075 Ga0207708_10594819 Ga0207708_105948192 129
205 3300026088 Ga0207641_10002499 Ga0207641_100024996 129
206 3300026088 Ga0207641_10244707 Ga0207641_102447072 129
207 3300026088 Ga0207641_10376153 Ga0207641_103761532 129
208 3300026089 Ga0207648_10001061 Ga0207648_1000106118 129
209 3300026095 Ga0207676_10003627 Ga0207676_1000362712 129
210 3300026118 Ga0207675_100316664 Ga0207675_1003166642 129
211 3300026121 Ga0207683_10000182 Ga0207683_1000018213 129
212 3300028379 Ga0268266_10032930 Ga0268266_100329303 129
213 3300028381 Ga0268264_10211851 Ga0268264_102118512 129
214 3300028381 Ga0268264_12648363 Ga0268264_126483631 129
215 3300031852 Ga0307410_10293814 Ga0307410_102938142 129
216 3300035118 Ga0373954_0022524 Ga0373954_0022524_2116_2562 129
217 3300041509 Ga0451843_0347911 Ga0451843_0347911_254_670 129
218 3300046539 Ga0495621_0072955 Ga0495621_0072955_148_579 129
219 3300047444 Ga0495675_0497842 Ga0495675_0497842_275_664 129
220 3300048903 Ga0496100_1064261 Ga0496100_1064261_226_615 129
221 3300048909 Ga0496106_0366717 Ga0496106_0366717_15_404 129
222 3300048912 Ga0496109_0172880 Ga0496109_0172880_523_912 129
223 3300048912 Ga0496109_0380919 Ga0496109_0380919_19_447 129
224 3300005327 Ga0070658_10834358 Ga0070658_108343582 130
225 3300005339 Ga0070660_100031003 Ga0070660_1000310032 130
226 3300005353 Ga0070669_100359315 Ga0070669_1003593152 130
227 3300005355 Ga0070671_101110178 Ga0070671_1011101782 130
228 3300005367 Ga0070667_100925567 Ga0070667_1009255672 130
229 3300005455 Ga0070663_100152575 Ga0070663_1001525752 130
230 3300005530 Ga0070679_100381424 Ga0070679_1003814242 130
231 3300005539 Ga0068853_100991127 Ga0068853_1009911272 130
232 3300005563 Ga0068855_100058236 Ga0068855_1000582362 130
233 3300005616 Ga0068852_100042015 Ga0068852_1000420151 130
234 3300005616 Ga0068852_100228231 Ga0068852_1002282312 130
235 3300005834 Ga0068851_10039544 Ga0068851_100395442 130
236 3300006358 Ga0068871_100395545 Ga0068871_1003955452 130
237 3300013104 Ga0157370_10424880 Ga0157370_104248802 130
238 3300013105 Ga0157369_10005645 Ga0157369_100056457 130
239 3300013307 Ga0157372_10153192 Ga0157372_101531923 130
240 3300025321 Ga0207656_10396560 Ga0207656_103965602 130
241 3300025909 Ga0207705_10058870 Ga0207705_100588703 130
242 3300025919 Ga0207657_10060294 Ga0207657_100602942 130
243 3300025949 Ga0207667_10109436 Ga0207667_101094362 130
244 3300026041 Ga0207639_10885937 Ga0207639_108859372 130
245 3300026142 Ga0207698_10053904 Ga0207698_100539044 130
246 3300026142 Ga0207698_10857715 Ga0207698_108577152 130
247 3300048090 Ga0495615_0188382 Ga0495615_0188382_55_453 130
248 3300049593 Ga0501077_0709302 Ga0501077_0709302_110_508 130
249 3300005328 Ga0070676_10018010 Ga0070676_100180102 131
250 3300005331 Ga0070670_100025285 Ga0070670_1000252852 131
251 3300005334 Ga0068869_100013466 Ga0068869_1000134664 131
252 3300005338 Ga0068868_100091422 Ga0068868_1000914222 131
253 3300005347 Ga0070668_100278411 Ga0070668_1002784112 131
254 3300005353 Ga0070669_100016453 Ga0070669_1000164532 131
255 3300005354 Ga0070675_100391028 Ga0070675_1003910281 131
256 3300005356 Ga0070674_100485717 Ga0070674_1004857172 131
257 3300005364 Ga0070673_100009947 Ga0070673_1000099473 131
258 3300005367 Ga0070667_100026344 Ga0070667_1000263441 131
259 3300005457 Ga0070662_101053928 Ga0070662_1010539281 131
260 3300005459 Ga0068867_100017814 Ga0068867_1000178147 131
261 3300005543 Ga0070672_100466241 Ga0070672_1004662412 131
262 3300005549 Ga0070704_100734616 Ga0070704_1007346162 131
263 3300005563 Ga0068855_100868097 Ga0068855_1008680972 131
264 3300005577 Ga0068857_100045071 Ga0068857_1000450713 131
265 3300005617 Ga0068859_100050149 Ga0068859_1000501494 131
266 3300005618 Ga0068864_100007820 Ga0068864_1000078208 131
267 3300005719 Ga0068861_100070825 Ga0068861_1000708252 131
268 3300005840 Ga0068870_10009446 Ga0068870_100094467 131
269 3300005841 Ga0068863_100614551 Ga0068863_1006145512 131
270 3300005842 Ga0068858_100009481 Ga0068858_10000948110 131
271 3300005843 Ga0068860_100011978 Ga0068860_1000119784 131
272 3300005844 Ga0068862_100040162 Ga0068862_1000401622 131
273 3300006931 Ga0097620_100050148 Ga0097620_1000501482 131
274 3300009011 Ga0105251_10576585 Ga0105251_105765851 131
275 3300009098 Ga0105245_10106559 Ga0105245_101065592 131
276 3300009101 Ga0105247_10073631 Ga0105247_100736312 131
277 3300009148 Ga0105243_10224778 Ga0105243_102247782 131
278 3300009177 Ga0105248_10033967 Ga0105248_100339674 131
279 3300009545 Ga0105237_11051590 Ga0105237_110515902 131
280 3300009553 Ga0105249_10671047 Ga0105249_106710472 131
281 3300013297 Ga0157378_10257898 Ga0157378_102578982 131
282 3300013306 Ga0163162_10399523 Ga0163162_103995232 131
283 3300013308 Ga0157375_10357898 Ga0157375_103578982 131
284 3300014325 Ga0163163_10028546 Ga0163163_100285467 131
285 3300014745 Ga0157377_11472668 Ga0157377_114726681 131
286 3300014968 Ga0157379_10011447 Ga0157379_100114478 131
287 3300025315 Ga0207697_10165818 Ga0207697_101658182 131
288 3300025900 Ga0207710_10273280 Ga0207710_102732802 131
289 3300025901 Ga0207688_10381353 Ga0207688_103813532 131
290 3300025907 Ga0207645_10209244 Ga0207645_102092442 131
291 3300025908 Ga0207643_10011788 Ga0207643_100117887 131
292 3300025914 Ga0207671_11306083 Ga0207671_113060832 131
293 3300025925 Ga0207650_10030308 Ga0207650_100303082 131
294 3300025926 Ga0207659_10176594 Ga0207659_101765943 131
295 3300025927 Ga0207687_10055595 Ga0207687_100555952 131
296 3300025931 Ga0207644_10196513 Ga0207644_101965132 131
297 3300025933 Ga0207706_10306462 Ga0207706_103064622 131
298 3300025937 Ga0207669_10947591 Ga0207669_109475912 131
299 3300025940 Ga0207691_10216759 Ga0207691_102167592 131
300 3300025941 Ga0207711_10064314 Ga0207711_100643143 131
301 3300025942 Ga0207689_10025220 Ga0207689_100252202 131
302 3300025949 Ga0207667_10504309 Ga0207667_105043092 131
303 3300025960 Ga0207651_10009370 Ga0207651_100093704 131
304 3300025986 Ga0207658_10093532 Ga0207658_100935322 131
305 3300026023 Ga0207677_10699640 Ga0207677_106996402 131
306 3300026035 Ga0207703_10005461 Ga0207703_1000546111 131
307 3300026067 Ga0207678_10971764 Ga0207678_109717642 131
308 3300026089 Ga0207648_10027228 Ga0207648_100272287 131
309 3300026095 Ga0207676_10056161 Ga0207676_100561614 131
310 3300026116 Ga0207674_10069424 Ga0207674_100694242 131
311 3300026118 Ga0207675_100027260 Ga0207675_1000272604 131
312 3300028380 Ga0268265_10028746 Ga0268265_100287462 131
313 3300028381 Ga0268264_10024915 Ga0268264_100249153 131
314 3300048906 Ga0496103_0066448 Ga0496103_0066448_457_879 131
315 3300048911 Ga0496108_0976297 Ga0496108_0976297_269_691 131
316 3300048912 Ga0496109_0037027 Ga0496109_0037027_119_541 131
317 3300048916 Ga0496113_0318797 Ga0496113_0318797_541_963 131
318 3300005330 Ga0070690_100788722 Ga0070690_1007887221 132
319 3300005331 Ga0070670_100128604 Ga0070670_1001286042 132
320 3300005331 Ga0070670_100281362 Ga0070670_1002813622 132
321 3300005331 Ga0070670_100351719 Ga0070670_1003517192 132
322 3300005344 Ga0070661_100764013 Ga0070661_1007640131 132
323 3300005347 Ga0070668_100016207 Ga0070668_1000162075 132
324 3300005347 Ga0070668_100024546 Ga0070668_1000245462 132
325 3300005347 Ga0070668_100549530 Ga0070668_1005495301 132
326 3300005353 Ga0070669_100759715 Ga0070669_1007597151 132
327 3300005353 Ga0070669_100844896 Ga0070669_1008448962 132
328 3300005354 Ga0070675_100990021 Ga0070675_1009900212 132
329 3300005355 Ga0070671_101047531 Ga0070671_1010475311 132
330 3300005364 Ga0070673_100044131 Ga0070673_1000441312 132
331 3300005365 Ga0070688_100832494 Ga0070688_1008324941 132
332 3300005365 Ga0070688_101431114 Ga0070688_1014311141 132
333 3300005367 Ga0070667_101189224 Ga0070667_1011892242 132
334 3300005367 Ga0070667_101510584 Ga0070667_1015105842 132
335 3300005436 Ga0070713_100000424 Ga0070713_1000004246 132
336 3300005543 Ga0070672_101837321 Ga0070672_1018373212 132
337 3300005564 Ga0070664_100905950 Ga0070664_1009059502 132
338 3300005615 Ga0070702_100324125 Ga0070702_1003241251 132
339 3300005719 Ga0068861_100472824 Ga0068861_1004728242 132
340 3300005834 Ga0068851_10702225 Ga0068851_107022252 132
341 3300005841 Ga0068863_100133549 Ga0068863_1001335492 132
342 3300005841 Ga0068863_100184831 Ga0068863_1001848312 132
343 3300005841 Ga0068863_100245339 Ga0068863_1002453392 132
344 3300005843 Ga0068860_100737000 Ga0068860_1007370002 132
345 3300005843 Ga0068860_101077104 Ga0068860_1010771042 132
346 3300005844 Ga0068862_100553737 Ga0068862_1005537372 132
347 3300006175 Ga0070712_100292287 Ga0070712_1002922872 132
348 3300006358 Ga0068871_100950877 Ga0068871_1009508771 132
349 3300006881 Ga0068865_100677128 Ga0068865_1006771282 132
350 3300009101 Ga0105247_10554085 Ga0105247_105540852 132
351 3300013296 Ga0157374_11214770 Ga0157374_112147702 132
352 3300013308 Ga0157375_10011665 Ga0157375_100116652 132
353 3300014325 Ga0163163_12855245 Ga0163163_128552451 132
354 3300014326 Ga0157380_10061710 Ga0157380_100617102 132
355 3300014968 Ga0157379_10874003 Ga0157379_108740032 132
356 3300025907 Ga0207645_10024272 Ga0207645_100242723 132
357 3300025915 Ga0207693_10276293 Ga0207693_102762932 132
358 3300025923 Ga0207681_10504516 Ga0207681_105045162 132
359 3300025923 Ga0207681_10719268 Ga0207681_107192682 132
360 3300025925 Ga0207650_10137026 Ga0207650_101370262 132
361 3300025925 Ga0207650_10222499 Ga0207650_102224991 132
362 3300025925 Ga0207650_10325641 Ga0207650_103256412 132
363 3300025928 Ga0207700_10000303 Ga0207700_100003038 132
364 3300025931 Ga0207644_11035642 Ga0207644_110356421 132
365 3300025937 Ga0207669_10692447 Ga0207669_106924472 132
366 3300025938 Ga0207704_10320150 Ga0207704_103201502 132
367 3300025945 Ga0207679_10046304 Ga0207679_100463043 132
368 3300025960 Ga0207651_10864787 Ga0207651_108647872 132
369 3300025972 Ga0207668_10062619 Ga0207668_100626192 132
370 3300025972 Ga0207668_10236172 Ga0207668_102361722 132
371 3300025986 Ga0207658_10370637 Ga0207658_103706371 132
372 3300026095 Ga0207676_10335135 Ga0207676_103351352 132
373 3300026118 Ga0207675_100204091 Ga0207675_1002040912 132
374 3300026118 Ga0207675_100263381 Ga0207675_1002633812 132
375 3300028380 Ga0268265_10203032 Ga0268265_102030322 132
376 3300028381 Ga0268264_10467640 Ga0268264_104676402 132
377 3300044673 Ga0453683_1120323 Ga0453683_1120323_40_453 132
378 3300046537 Ga0495598_0087475 Ga0495598_0087475_143_553 132
379 3300047470 Ga0495681_0290852 Ga0495681_0290852_115_522 132
380 3300047471 Ga0495684_0376301 Ga0495684_0376301_277_702 132
381 3300048911 Ga0496108_0657190 Ga0496108_0657190_306_749 132
382 3300048913 Ga0496110_0186820 Ga0496110_0186820_23_451 132
383 3300048917 Ga0496114_0525989 Ga0496114_0525989_404_814 132
384 3300048918 Ga0496115_1097740 Ga0496115_1097740_39_449 132
385 3300049578 Ga0501042_0371809 Ga0501042_0371809_11_430 132
386 3300053084 Ga0495595_0225165 Ga0495595_0225165_501_899 132
387 3300053085 Ga0495619_0086415 Ga0495619_0086415_359_784 132
388 3300005339 Ga0070660_100256953 Ga0070660_1002569532 133
389 3300005353 Ga0070669_100073880 Ga0070669_1000738802 133
390 3300005354 Ga0070675_100914704 Ga0070675_1009147042 133
391 3300005364 Ga0070673_100415718 Ga0070673_1004157182 133
392 3300005366 Ga0070659_100233368 Ga0070659_1002333682 133
393 3300005367 Ga0070667_100102596 Ga0070667_1001025962 133
394 3300005457 Ga0070662_100163914 Ga0070662_1001639142 133
395 3300005539 Ga0068853_101293217 Ga0068853_1012932171 133
396 3300005543 Ga0070672_100037099 Ga0070672_1000370993 133
397 3300005616 Ga0068852_100457470 Ga0068852_1004574702 133
398 3300005842 Ga0068858_100425777 Ga0068858_1004257772 133
399 3300006237 Ga0097621_101888434 Ga0097621_1018884342 133
400 3300009177 Ga0105248_10028894 Ga0105248_100288944 133
401 3300012512 Ga0157327_1057345 Ga0157327_10573452 133
402 3300014968 Ga0157379_10273397 Ga0157379_102733971 133
403 3300025903 Ga0207680_10152097 Ga0207680_101520972 133
404 3300025919 Ga0207657_10113335 Ga0207657_101133353 133
405 3300025931 Ga0207644_10004203 Ga0207644_100042032 133
406 3300025933 Ga0207706_10069845 Ga0207706_100698452 133
407 3300025940 Ga0207691_10054949 Ga0207691_100549492 133
408 3300025941 Ga0207711_10002413 Ga0207711_100024132 133
409 3300025960 Ga0207651_10597306 Ga0207651_105973062 133
410 3300025972 Ga0207668_10203527 Ga0207668_102035272 133
411 3300025986 Ga0207658_10456201 Ga0207658_104562012 133
412 3300026035 Ga0207703_10746326 Ga0207703_107463262 133
413 3300026041 Ga0207639_10479882 Ga0207639_104798822 133
414 3300026118 Ga0207675_100376927 Ga0207675_1003769272 133
415 3300026142 Ga0207698_10408943 Ga0207698_104089432 133
416 3300035085 Ga0373929_0087617 Ga0373929_0087617_104_517 133
417 3300035090 Ga0373949_0147588 Ga0373949_0147588_175_588 133
418 3300046543 Ga0495645_0046403 Ga0495645_0046403_2683_3144 133
419 3300048909 Ga0496106_0347346 Ga0496106_0347346_86_487 133
420 3300048910 Ga0496107_0386393 Ga0496107_0386393_183_629 133
421 3300048912 Ga0496109_0756918 Ga0496109_0756918_260_706 133
422 3300005339 Ga0070660_100003276 Ga0070660_1000032763 134
423 3300005530 Ga0070679_100364767 Ga0070679_1003647672 134
424 3300013104 Ga0157370_10022983 Ga0157370_100229835 134
425 3300013105 Ga0157369_10112967 Ga0157369_101129672 134
426 3300013307 Ga0157372_10412591 Ga0157372_104125912 134
427 3300025912 Ga0207707_10041527 Ga0207707_100415272 134
428 3300025919 Ga0207657_10042319 Ga0207657_100423193 134
429 3300048909 Ga0496106_1093438 Ga0496106_1093438_77_508 134
430 3300002239 JGI24034J26672_10049560 JGI24034J26672_100495601 135
431 3300005289 Ga0065704_10676556 Ga0065704_106765561 135
432 3300005290 Ga0065712_10493920 Ga0065712_104939201 135
433 3300005293 Ga0065715_10499012 Ga0065715_104990122 135
434 3300005328 Ga0070676_10046474 Ga0070676_100464742 135
435 3300005330 Ga0070690_100001139 Ga0070690_1000011394 135
436 3300005330 Ga0070690_100131175 Ga0070690_1001311752 135
437 3300005331 Ga0070670_100471007 Ga0070670_1004710072 135
438 3300005335 Ga0070666_10042890 Ga0070666_100428903 135
439 3300005337 Ga0070682_100234857 Ga0070682_1002348572 135
440 3300005338 Ga0068868_100002830 Ga0068868_1000028304 135
441 3300005340 Ga0070689_100001809 Ga0070689_1000018099 135
442 3300005354 Ga0070675_100881348 Ga0070675_1008813482 135
443 3300005355 Ga0070671_100020844 Ga0070671_1000208442 135
444 3300005355 Ga0070671_100038268 Ga0070671_1000382682 135
445 3300005355 Ga0070671_100071122 Ga0070671_1000711223 135
446 3300005356 Ga0070674_100024754 Ga0070674_1000247542 135
447 3300005364 Ga0070673_100006326 Ga0070673_1000063266 135
448 3300005366 Ga0070659_100098361 Ga0070659_1000983612 135
449 3300005367 Ga0070667_100034520 Ga0070667_1000345202 135
450 3300005434 Ga0070709_10286028 Ga0070709_102860282 135
451 3300005436 Ga0070713_100050119 Ga0070713_1000501194 135
452 3300005437 Ga0070710_10149882 Ga0070710_101498822 135
453 3300005438 Ga0070701_10055555 Ga0070701_100555552 135
454 3300005438 Ga0070701_10974020 Ga0070701_109740201 135
455 3300005440 Ga0070705_100170336 Ga0070705_1001703362 135
456 3300005441 Ga0070700_100926501 Ga0070700_1009265011 135
457 3300005455 Ga0070663_100586541 Ga0070663_1005865412 135
458 3300005456 Ga0070678_100060857 Ga0070678_1000608573 135
459 3300005457 Ga0070662_100674522 Ga0070662_1006745221 135
460 3300005459 Ga0068867_100402025 Ga0068867_1004020252 135
461 3300005466 Ga0070685_10130867 Ga0070685_101308672 135
462 3300005543 Ga0070672_100669203 Ga0070672_1006692032 135
463 3300005546 Ga0070696_101110954 Ga0070696_1011109542 135
464 3300005547 Ga0070693_100010185 Ga0070693_1000101854 135
465 3300005548 Ga0070665_100091056 Ga0070665_1000910563 135
466 3300005563 Ga0068855_100312328 Ga0068855_1003123282 135
467 3300005563 Ga0068855_101486415 Ga0068855_1014864152 135
468 3300005564 Ga0070664_100138061 Ga0070664_1001380612 135
469 3300005577 Ga0068857_100338907 Ga0068857_1003389072 135
470 3300005614 Ga0068856_100031280 Ga0068856_1000312805 135
471 3300005614 Ga0068856_101555903 Ga0068856_1015559032 135
472 3300005615 Ga0070702_100121224 Ga0070702_1001212242 135
473 3300005616 Ga0068852_100166816 Ga0068852_1001668163 135
474 3300005617 Ga0068859_100021504 Ga0068859_1000215045 135
475 3300005618 Ga0068864_100005689 Ga0068864_1000056892 135
476 3300005840 Ga0068870_10041457 Ga0068870_100414572 135
477 3300005841 Ga0068863_100040268 Ga0068863_1000402684 135
478 3300005844 Ga0068862_101574161 Ga0068862_1015741612 135
479 3300006173 Ga0070716_100018307 Ga0070716_1000183073 135
480 3300006237 Ga0097621_100130443 Ga0097621_1001304432 135
481 3300006237 Ga0097621_100172069 Ga0097621_1001720692 135
482 3300006358 Ga0068871_100159519 Ga0068871_1001595192 135
483 3300006358 Ga0068871_100591838 Ga0068871_1005918382 135
484 3300006871 Ga0075434_101018218 Ga0075434_1010182181 135
485 3300006931 Ga0097620_100021504 Ga0097620_1000215043 135
486 3300007076 Ga0075435_100221938 Ga0075435_1002219382 135
487 3300009098 Ga0105245_10054914 Ga0105245_100549142 135
488 3300009101 Ga0105247_10059653 Ga0105247_100596532 135
489 3300009101 Ga0105247_10739931 Ga0105247_107399312 135
490 3300009174 Ga0105241_10099424 Ga0105241_100994242 135
491 3300009176 Ga0105242_10141206 Ga0105242_101412062 135
492 3300009176 Ga0105242_10990026 Ga0105242_109900262 135
493 3300009177 Ga0105248_10243116 Ga0105248_102431162 135
494 3300009545 Ga0105237_10127731 Ga0105237_101277313 135
495 3300009545 Ga0105237_10568705 Ga0105237_105687052 135
496 3300009551 Ga0105238_10174574 Ga0105238_101745742 135
497 3300009553 Ga0105249_10157287 Ga0105249_101572873 135
498 3300010375 Ga0105239_10179968 Ga0105239_101799682 135
499 3300011119 Ga0105246_10015957 Ga0105246_100159573 135
500 3300013102 Ga0157371_10274012 Ga0157371_102740121 135
501 3300013105 Ga0157369_10156053 Ga0157369_101560532 135
502 3300013296 Ga0157374_10026573 Ga0157374_100265735 135
503 3300013297 Ga0157378_10024096 Ga0157378_100240962 135
504 3300013297 Ga0157378_10037169 Ga0157378_100371694 135
505 3300013297 Ga0157378_10057589 Ga0157378_100575892 135
506 3300013306 Ga0163162_10030584 Ga0163162_100305842 135
507 3300013306 Ga0163162_10210375 Ga0163162_102103752 135
508 3300013306 Ga0163162_10650675 Ga0163162_106506752 135
509 3300013306 Ga0163162_10771836 Ga0163162_107718362 135
510 3300013306 Ga0163162_10862073 Ga0163162_108620732 135
511 3300013307 Ga0157372_11086970 Ga0157372_110869702 135
512 3300013308 Ga0157375_11488687 Ga0157375_114886871 135
513 3300014325 Ga0163163_10001943 Ga0163163_100019439 135
514 3300014745 Ga0157377_10227125 Ga0157377_102271252 135
515 3300014968 Ga0157379_10004613 Ga0157379_100046132 135
516 3300014969 Ga0157376_10039108 Ga0157376_100391082 135
517 3300017792 Ga0163161_10138470 Ga0163161_101384703 135
518 3300025898 Ga0207692_10041023 Ga0207692_100410233 135
519 3300025899 Ga0207642_10004984 Ga0207642_100049845 135
520 3300025899 Ga0207642_10882496 Ga0207642_108824962 135
521 3300025903 Ga0207680_10001960 Ga0207680_100019605 135
522 3300025903 Ga0207680_10011322 Ga0207680_100113222 135
523 3300025908 Ga0207643_10018035 Ga0207643_100180351 135
524 3300025911 Ga0207654_10007902 Ga0207654_100079025 135
525 3300025914 Ga0207671_10393320 Ga0207671_103933202 135
526 3300025914 Ga0207671_10814567 Ga0207671_108145672 135
527 3300025915 Ga0207693_10002204 Ga0207693_1000220411 135
528 3300025916 Ga0207663_10018661 Ga0207663_100186614 135
529 3300025924 Ga0207694_10323403 Ga0207694_103234032 135
530 3300025925 Ga0207650_10253672 Ga0207650_102536722 135
531 3300025927 Ga0207687_10000381 Ga0207687_1000038125 135
532 3300025927 Ga0207687_10020446 Ga0207687_100204464 135
533 3300025928 Ga0207700_10146088 Ga0207700_101460882 135
534 3300025931 Ga0207644_10013329 Ga0207644_100133294 135
535 3300025931 Ga0207644_10051698 Ga0207644_100516983 135
536 3300025931 Ga0207644_10179914 Ga0207644_101799142 135
537 3300025932 Ga0207690_10323517 Ga0207690_103235172 135
538 3300025933 Ga0207706_11274783 Ga0207706_112747831 135
539 3300025934 Ga0207686_10000089 Ga0207686_1000008944 135
540 3300025934 Ga0207686_10276792 Ga0207686_102767921 135
541 3300025937 Ga0207669_10198113 Ga0207669_101981132 135
542 3300025939 Ga0207665_10001668 Ga0207665_100016683 135
543 3300025942 Ga0207689_10077292 Ga0207689_100772922 135
544 3300025945 Ga0207679_10650159 Ga0207679_106501592 135
545 3300025949 Ga0207667_10190913 Ga0207667_101909132 135
546 3300025949 Ga0207667_10918522 Ga0207667_109185222 135
547 3300025960 Ga0207651_10070333 Ga0207651_100703332 135
548 3300025961 Ga0207712_10088653 Ga0207712_100886533 135
549 3300025981 Ga0207640_10007051 Ga0207640_100070515 135
550 3300025986 Ga0207658_10071981 Ga0207658_100719812 135
551 3300025986 Ga0207658_10127466 Ga0207658_101274663 135
552 3300026023 Ga0207677_10000334 Ga0207677_1000033429 135
553 3300026035 Ga0207703_10002343 Ga0207703_100023436 135
554 3300026067 Ga0207678_10126372 Ga0207678_101263722 135
555 3300026078 Ga0207702_10164898 Ga0207702_101648982 135
556 3300026088 Ga0207641_10054673 Ga0207641_100546734 135
557 3300026089 Ga0207648_10198501 Ga0207648_101985012 135
558 3300026089 Ga0207648_10399545 Ga0207648_103995452 135
559 3300026095 Ga0207676_10000507 Ga0207676_1000050715 135
560 3300026116 Ga0207674_10839452 Ga0207674_108394522 135
561 3300026118 Ga0207675_102608489 Ga0207675_1026084891 135
562 3300026121 Ga0207683_10000354 Ga0207683_1000035433 135
563 3300026121 Ga0207683_10215763 Ga0207683_102157632 135
564 3300026121 Ga0207683_10417759 Ga0207683_104177592 135
565 3300028380 Ga0268265_10049388 Ga0268265_100493882 135
566 3300028381 Ga0268264_10017649 Ga0268264_100176492 135
567 3300028381 Ga0268264_10033683 Ga0268264_100336835 135
568 3300035083 Ga0373926_0106288 Ga0373926_0106288_335_766 135
569 3300035086 Ga0373934_0023910 Ga0373934_0023910_140_547 135
570 3300035086 Ga0373934_0123104 Ga0373934_0123104_569_1000 135
571 3300035113 Ga0373936_0357822 Ga0373936_0357822_127_534 135
572 3300035116 Ga0373945_0006562 Ga0373945_0006562_569_976 135
573 3300035116 Ga0373945_0048460 Ga0373945_0048460_1059_1490 135
574 3300035118 Ga0373954_0003857 Ga0373954_0003857_1772_2179 135
575 3300035118 Ga0373954_0062021 Ga0373954_0062021_424_855 135
576 3300035119 Ga0373956_0006805 Ga0373956_0006805_2557_2964 135
577 3300035119 Ga0373956_0159857 Ga0373956_0159857_605_1036 135
578 3300035120 Ga0373957_0016834 Ga0373957_0016834_232_639 135
579 3300035170 Ga0373943_0009086 Ga0373943_0009086_2239_2670 135
580 3300035170 Ga0373943_0010835 Ga0373943_0010835_905_1312 135
581 3300035171 Ga0373946_0145370 Ga0373946_0145370_536_943 135
582 3300035172 Ga0373955_0019009 Ga0373955_0019009_590_997 135
583 3300035410 Ga0373924_0010622 Ga0373924_0010622_2357_2764 135
584 3300035692 Ga0373935_0017451 Ga0373935_0017451_3317_3748 135
585 3300035692 Ga0373935_0958167 Ga0373935_0958167_141_572 135
586 3300035695 Ga0373927_0005157 Ga0373927_0005157_6726_7157 135
587 3300035695 Ga0373927_0060209 Ga0373927_0060209_1908_2315 135
588 3300035724 Ga0373933_0111566 Ga0373933_0111566_1124_1555 135
589 3300035725 Ga0373947_0009444 Ga0373947_0009444_5126_5533 135
590 3300036401 Ga0373937_0723186 Ga0373937_0723186_443_850 135
591 3300037068 Ga0373925_0004419 Ga0373925_0004419_608_1039 135
592 3300037068 Ga0373925_0027420 Ga0373925_0027420_409_840 135
593 3300037068 Ga0373925_0109280 Ga0373925_0109280_903_1310 135
594 3300045051 Ga0451576_0905099 Ga0451576_0905099_358_765 135
595 3300046459 Ga0495629_0004825 Ga0495629_0004825_553_984 135
596 3300046463 Ga0495653_0188908 Ga0495653_0188908_934_1365 135
597 3300046472 Ga0495580_0167491 Ga0495580_0167491_721_1152 135
598 3300046472 Ga0495580_0680614 Ga0495580_0680614_178_609 135
599 3300046473 Ga0495582_0084900 Ga0495582_0084900_608_1039 135
600 3300046475 Ga0495639_0009426 Ga0495639_0009426_1072_1503 135
601 3300046476 Ga0495662_0146604 Ga0495662_0146604_549_980 135
602 3300046477 Ga0495664_0510738 Ga0495664_0510738_295_702 135
603 3300046499 Ga0495594_0014259 Ga0495594_0014259_2238_2669 135
604 3300046514 Ga0495618_0614541 Ga0495618_0614541_161_592 135
605 3300046526 Ga0495666_0049663 Ga0495666_0049663_1320_1751 135
606 3300046531 Ga0495665_0016597 Ga0495665_0016597_608_1039 135
607 3300046533 Ga0495640_0047243 Ga0495640_0047243_1700_2131 135
608 3300046533 Ga0495640_0784610 Ga0495640_0784610_25_432 135
609 3300046535 Ga0495586_0820120 Ga0495586_0820120_49_480 135
610 3300046539 Ga0495621_0019081 Ga0495621_0019081_313_744 135
611 3300046559 Ga0495667_0287763 Ga0495667_0287763_150_557 135
612 3300046663 Ga0495635_0072763 Ga0495635_0072763_1783_2214 135
613 3300046664 Ga0495659_0006548 Ga0495659_0006548_1794_2225 135
614 3300046674 Ga0495588_0047383 Ga0495588_0047383_72_503 135
615 3300046675 Ga0495657_0118409 Ga0495657_0118409_922_1329 135
616 3300046679 Ga0495623_0491963 Ga0495623_0491963_205_612 135
617 3300046681 Ga0495647_0015961 Ga0495647_0015961_1925_2356 135
618 3300046683 Ga0495658_0176899 Ga0495658_0176899_284_715 135
619 3300046689 Ga0495613_0059968 Ga0495613_0059968_1823_2254 135
620 3300046690 Ga0495624_0308751 Ga0495624_0308751_64_495 135
621 3300046809 Ga0495600_0186773 Ga0495600_0186773_222_653 135
622 3300046809 Ga0495600_0805755 Ga0495600_0805755_88_495 135
623 3300047315 Ga0495581_0004194 Ga0495581_0004194_7271_7702 135
624 3300047319 Ga0495674_0652218 Ga0495674_0652218_403_810 135
625 3300047322 Ga0495680_0002877 Ga0495680_0002877_10584_11015 135
626 3300047444 Ga0495675_0112977 Ga0495675_0112977_864_1271 135
627 3300047471 Ga0495684_0065156 Ga0495684_0065156_1273_1704 135
628 3300047471 Ga0495684_0091125 Ga0495684_0091125_850_1257 135
629 3300047673 Ga0495593_0047848 Ga0495593_0047848_172_603 135
630 3300048907 Ga0496104_0008572 Ga0496104_0008572_6388_6795 135
631 3300048908 Ga0496105_0058419 Ga0496105_0058419_655_1062 135
632 3300048909 Ga0496106_0187832 Ga0496106_0187832_176_583 135
633 3300048910 Ga0496107_0023453 Ga0496107_0023453_2640_3047 135
634 3300048912 Ga0496109_0055578 Ga0496109_0055578_2647_3060 135
635 3300048914 Ga0496111_0696137 Ga0496111_0696137_279_692 135
636 3300048915 Ga0496112_0001106 Ga0496112_0001106_14823_15230 135
637 3300048916 Ga0496113_1421377 Ga0496113_1421377_110_523 135
638 3300048918 Ga0496115_0096204 Ga0496115_0096204_628_1035 135
639 3300050512 nmdc:mga0n895_1042603_c1 nmdc:mga0n895_1042603_c1_54_461 135
640 3300050513 nmdc:mga0rr50_643620_c1 nmdc:mga0rr50_643620_c1_221_628 135
641 3300053085 Ga0495619_0093105 Ga0495619_0093105_1150_1581 135
642 3300005328 Ga0070676_10366648 Ga0070676_103666482 136
643 3300005330 Ga0070690_100021447 Ga0070690_1000214472 136
644 3300005331 Ga0070670_100146833 Ga0070670_1001468332 136
645 3300005331 Ga0070670_100356816 Ga0070670_1003568162 136
646 3300005334 Ga0068869_100102712 Ga0068869_1001027123 136
647 3300005334 Ga0068869_102097676 Ga0068869_1020976761 136
648 3300005338 Ga0068868_100268493 Ga0068868_1002684932 136
649 3300005338 Ga0068868_100389266 Ga0068868_1003892662 136
650 3300005340 Ga0070689_100159834 Ga0070689_1001598342 136
651 3300005343 Ga0070687_100730051 Ga0070687_1007300511 136
652 3300005347 Ga0070668_100154733 Ga0070668_1001547332 136
653 3300005347 Ga0070668_100184178 Ga0070668_1001841782 136
654 3300005347 Ga0070668_100268362 Ga0070668_1002683622 136
655 3300005353 Ga0070669_100095576 Ga0070669_1000955762 136
656 3300005354 Ga0070675_100018349 Ga0070675_1000183492 136
657 3300005355 Ga0070671_100534921 Ga0070671_1005349212 136
658 3300005355 Ga0070671_100758577 Ga0070671_1007585771 136
659 3300005356 Ga0070674_101250286 Ga0070674_1012502861 136
660 3300005364 Ga0070673_100248097 Ga0070673_1002480972 136
661 3300005365 Ga0070688_100029155 Ga0070688_1000291554 136
662 3300005366 Ga0070659_101008631 Ga0070659_1010086312 136
663 3300005367 Ga0070667_100078488 Ga0070667_1000784883 136
664 3300005367 Ga0070667_100511293 Ga0070667_1005112931 136
665 3300005441 Ga0070700_101113885 Ga0070700_1011138851 136
666 3300005456 Ga0070678_100353604 Ga0070678_1003536042 136
667 3300005456 Ga0070678_100446965 Ga0070678_1004469652 136
668 3300005459 Ga0068867_100095906 Ga0068867_1000959063 136
669 3300005459 Ga0068867_100177835 Ga0068867_1001778352 136
670 3300005459 Ga0068867_100326117 Ga0068867_1003261172 136
671 3300005543 Ga0070672_100002980 Ga0070672_1000029803 136
672 3300005543 Ga0070672_100026381 Ga0070672_1000263812 136
673 3300005543 Ga0070672_100657603 Ga0070672_1006576032 136
674 3300005544 Ga0070686_100905738 Ga0070686_1009057381 136
675 3300005578 Ga0068854_100902555 Ga0068854_1009025552 136
676 3300005617 Ga0068859_100075709 Ga0068859_1000757094 136
677 3300005617 Ga0068859_100410842 Ga0068859_1004108422 136
678 3300005617 Ga0068859_102086085 Ga0068859_1020860851 136
679 3300005618 Ga0068864_100026230 Ga0068864_1000262303 136
680 3300005618 Ga0068864_100806923 Ga0068864_1008069232 136
681 3300005718 Ga0068866_10255947 Ga0068866_102559472 136
682 3300005719 Ga0068861_100288357 Ga0068861_1002883572 136
683 3300005719 Ga0068861_101238494 Ga0068861_1012384942 136
684 3300005719 Ga0068861_102259578 Ga0068861_1022595781 136
685 3300005840 Ga0068870_10103862 Ga0068870_101038622 136
686 3300005840 Ga0068870_10104265 Ga0068870_101042652 136
687 3300005841 Ga0068863_100082816 Ga0068863_1000828162 136
688 3300005841 Ga0068863_100087393 Ga0068863_1000873933 136
689 3300005841 Ga0068863_100329348 Ga0068863_1003293482 136
690 3300005841 Ga0068863_101746429 Ga0068863_1017464291 136
691 3300005843 Ga0068860_100693951 Ga0068860_1006939512 136
692 3300005843 Ga0068860_100739959 Ga0068860_1007399592 136
693 3300005843 Ga0068860_100784480 Ga0068860_1007844802 136
694 3300005844 Ga0068862_100699260 Ga0068862_1006992602 136
695 3300006237 Ga0097621_100132403 Ga0097621_1001324032 136
696 3300006237 Ga0097621_100359234 Ga0097621_1003592342 136
697 3300006358 Ga0068871_100144622 Ga0068871_1001446222 136
698 3300006358 Ga0068871_100365152 Ga0068871_1003651522 136
699 3300006844 Ga0075428_101274171 Ga0075428_1012741712 136
700 3300006881 Ga0068865_100231314 Ga0068865_1002313142 136
701 3300006881 Ga0068865_100933105 Ga0068865_1009331052 136
702 3300006931 Ga0097620_100075706 Ga0097620_1000757062 136
703 3300006931 Ga0097620_100410829 Ga0097620_1004108292 136
704 3300006931 Ga0097620_102085607 Ga0097620_1020856071 136
705 3300009094 Ga0111539_12894717 Ga0111539_128947172 136
706 3300009098 Ga0105245_10604356 Ga0105245_106043562 136
707 3300009177 Ga0105248_10187349 Ga0105248_101873493 136
708 3300009177 Ga0105248_11054633 Ga0105248_110546332 136
709 3300012503 Ga0157313_1031620 Ga0157313_10316201 136
710 3300013296 Ga0157374_11425163 Ga0157374_114251632 136
711 3300013297 Ga0157378_10025030 Ga0157378_100250302 136
712 3300013297 Ga0157378_12209362 Ga0157378_122093621 136
713 3300013306 Ga0163162_10167876 Ga0163162_101678762 136
714 3300013308 Ga0157375_10387885 Ga0157375_103878852 136
715 3300013308 Ga0157375_10521880 Ga0157375_105218802 136
716 3300014325 Ga0163163_10194890 Ga0163163_101948901 136
717 3300014326 Ga0157380_10133702 Ga0157380_101337022 136
718 3300014326 Ga0157380_10799357 Ga0157380_107993572 136
719 3300014968 Ga0157379_10602967 Ga0157379_106029672 136
720 3300014968 Ga0157379_10687145 Ga0157379_106871452 136
721 3300014969 Ga0157376_10004217 Ga0157376_100042173 136
722 3300014969 Ga0157376_10191046 Ga0157376_101910462 136
723 3300014969 Ga0157376_10558642 Ga0157376_105586422 136
724 3300014969 Ga0157376_10616598 Ga0157376_106165982 136
725 3300017792 Ga0163161_10082833 Ga0163161_100828332 136
726 3300017792 Ga0163161_11093640 Ga0163161_110936401 136
727 3300017792 Ga0163161_11099519 Ga0163161_110995192 136
728 3300025903 Ga0207680_10076553 Ga0207680_100765531 136
729 3300025907 Ga0207645_10150011 Ga0207645_101500112 136
730 3300025908 Ga0207643_10006062 Ga0207643_100060622 136
731 3300025918 Ga0207662_10395810 Ga0207662_103958103 136
732 3300025923 Ga0207681_10835062 Ga0207681_108350622 136
733 3300025923 Ga0207681_10973829 Ga0207681_109738292 136
734 3300025925 Ga0207650_10523885 Ga0207650_105238852 136
735 3300025926 Ga0207659_10017962 Ga0207659_100179622 136
736 3300025926 Ga0207659_10195609 Ga0207659_101956092 136
737 3300025931 Ga0207644_10149666 Ga0207644_101496662 136
738 3300025931 Ga0207644_10452945 Ga0207644_104529452 136
739 3300025931 Ga0207644_10673382 Ga0207644_106733822 136
740 3300025931 Ga0207644_10734846 Ga0207644_107348462 136
741 3300025933 Ga0207706_10319531 Ga0207706_103195312 136
742 3300025936 Ga0207670_10411639 Ga0207670_104116392 136
743 3300025937 Ga0207669_10228757 Ga0207669_102287572 136
744 3300025937 Ga0207669_10390155 Ga0207669_103901552 136
745 3300025938 Ga0207704_10229411 Ga0207704_102294112 136
746 3300025938 Ga0207704_10239130 Ga0207704_102391301 136
747 3300025940 Ga0207691_10018378 Ga0207691_100183786 136
748 3300025940 Ga0207691_10030841 Ga0207691_100308414 136
749 3300025940 Ga0207691_10093361 Ga0207691_100933612 136
750 3300025940 Ga0207691_11574803 Ga0207691_115748031 136
751 3300025941 Ga0207711_10198666 Ga0207711_101986662 136
752 3300025942 Ga0207689_10024071 Ga0207689_100240715 136
753 3300025972 Ga0207668_10038434 Ga0207668_100384342 136
754 3300025972 Ga0207668_10346068 Ga0207668_103460682 136
755 3300025972 Ga0207668_11106839 Ga0207668_111068392 136
756 3300025986 Ga0207658_10103919 Ga0207658_101039192 136
757 3300026023 Ga0207677_10122641 Ga0207677_101226412 136
758 3300026023 Ga0207677_10332118 Ga0207677_103321182 136
759 3300026023 Ga0207677_11031836 Ga0207677_110318361 136
760 3300026075 Ga0207708_10143147 Ga0207708_101431472 136
761 3300026075 Ga0207708_10407846 Ga0207708_104078462 136
762 3300026088 Ga0207641_10314749 Ga0207641_103147492 136
763 3300026088 Ga0207641_10729078 Ga0207641_107290782 136
764 3300026089 Ga0207648_10406436 Ga0207648_104064362 136
765 3300026089 Ga0207648_11265930 Ga0207648_112659302 136
766 3300026095 Ga0207676_10737223 Ga0207676_107372232 136
767 3300026118 Ga0207675_100412582 Ga0207675_1004125822 136
768 3300026118 Ga0207675_100424741 Ga0207675_1004247412 136
769 3300026118 Ga0207675_101373885 Ga0207675_1013738851 136
770 3300026121 Ga0207683_10608062 Ga0207683_106080622 136
771 3300028379 Ga0268266_10040992 Ga0268266_100409924 136
772 3300028379 Ga0268266_10143050 Ga0268266_101430502 136
773 3300028380 Ga0268265_10029037 Ga0268265_100290374 136
774 3300028380 Ga0268265_11110899 Ga0268265_111108992 136
775 3300028381 Ga0268264_10809920 Ga0268264_108099202 136
776 3300028381 Ga0268264_10916539 Ga0268264_109165392 136
777 3300036401 Ga0373937_0707513 Ga0373937_0707513_253_702 136
778 3300041512 Ga0451853_1874952 Ga0451853_1874952_103_513 136
779 3300046543 Ga0495645_0009252 Ga0495645_0009252_5032_5481 136
780 3300048912 Ga0496109_1753815 Ga0496109_1753815_33_443 136
781 3300049588 Ga0501072_0209680 Ga0501072_0209680_816_1268 136
782 3300053077 Ga0495601_0230047 Ga0495601_0230047_567_1016 136
783 3300005617 Ga0068859_102517368 Ga0068859_1025173681 137
784 3300006931 Ga0097620_102517377 Ga0097620_1025173771 137
785 3300013307 Ga0157372_13311173 Ga0157372_133111731 137
786 3300001976 JGI24752J21851_1002012 JGI24752J21851_10020122 138
787 3300002239 JGI24034J26672_10005355 JGI24034J26672_100053552 138
788 3300005290 Ga0065712_10015926 Ga0065712_100159262 138
789 3300005293 Ga0065715_10003738 Ga0065715_100037385 138
790 3300005327 Ga0070658_10286898 Ga0070658_102868982 138
791 3300005329 Ga0070683_100046360 Ga0070683_1000463602 138
792 3300005330 Ga0070690_100033209 Ga0070690_1000332093 138
793 3300005331 Ga0070670_100423911 Ga0070670_1004239112 138
794 3300005331 Ga0070670_100538010 Ga0070670_1005380102 138
795 3300005333 Ga0070677_10011152 Ga0070677_100111522 138
796 3300005334 Ga0068869_100036189 Ga0068869_1000361892 138
797 3300005335 Ga0070666_10427625 Ga0070666_104276251 138
798 3300005335 Ga0070666_10762429 Ga0070666_107624291 138
799 3300005340 Ga0070689_100048305 Ga0070689_1000483053 138
800 3300005344 Ga0070661_100090788 Ga0070661_1000907882 138
801 3300005345 Ga0070692_10245793 Ga0070692_102457931 138
802 3300005347 Ga0070668_101508636 Ga0070668_1015086361 138
803 3300005353 Ga0070669_100672393 Ga0070669_1006723932 138
804 3300005353 Ga0070669_100852370 Ga0070669_1008523701 138
805 3300005354 Ga0070675_100493742 Ga0070675_1004937422 138
806 3300005356 Ga0070674_100138584 Ga0070674_1001385842 138
807 3300005364 Ga0070673_100352505 Ga0070673_1003525052 138
808 3300005364 Ga0070673_100431764 Ga0070673_1004317642 138
809 3300005365 Ga0070688_100040461 Ga0070688_1000404613 138
810 3300005366 Ga0070659_100083410 Ga0070659_1000834102 138
811 3300005367 Ga0070667_100071133 Ga0070667_1000711331 138
812 3300005367 Ga0070667_100445074 Ga0070667_1004450741 138
813 3300005437 Ga0070710_11170573 Ga0070710_111705731 138
814 3300005440 Ga0070705_100580069 Ga0070705_1005800691 138
815 3300005441 Ga0070700_100032042 Ga0070700_1000320422 138
816 3300005455 Ga0070663_100054084 Ga0070663_1000540843 138
817 3300005456 Ga0070678_100098619 Ga0070678_1000986192 138
818 3300005459 Ga0068867_101688919 Ga0068867_1016889191 138
819 3300005459 Ga0068867_101802437 Ga0068867_1018024371 138
820 3300005466 Ga0070685_10471119 Ga0070685_104711191 138
821 3300005535 Ga0070684_100128048 Ga0070684_1001280482 138
822 3300005539 Ga0068853_100457054 Ga0068853_1004570541 138
823 3300005543 Ga0070672_100536813 Ga0070672_1005368132 138
824 3300005543 Ga0070672_101260256 Ga0070672_1012602561 138
825 3300005564 Ga0070664_100577288 Ga0070664_1005772882 138
826 3300005577 Ga0068857_100192957 Ga0068857_1001929572 138
827 3300005578 Ga0068854_100080515 Ga0068854_1000805152 138
828 3300005615 Ga0070702_100030022 Ga0070702_1000300223 138
829 3300005616 Ga0068852_100312737 Ga0068852_1003127372 138
830 3300005616 Ga0068852_100954428 Ga0068852_1009544282 138
831 3300005617 Ga0068859_100495589 Ga0068859_1004955891 138
832 3300005618 Ga0068864_100056646 Ga0068864_1000566462 138
833 3300005718 Ga0068866_10103463 Ga0068866_101034632 138
834 3300005719 Ga0068861_100187476 Ga0068861_1001874762 138
835 3300005719 Ga0068861_100875224 Ga0068861_1008752241 138
836 3300005834 Ga0068851_10585496 Ga0068851_105854961 138
837 3300005841 Ga0068863_100257268 Ga0068863_1002572682 138
838 3300005841 Ga0068863_100416053 Ga0068863_1004160532 138
839 3300005842 Ga0068858_100412343 Ga0068858_1004123432 138
840 3300005843 Ga0068860_100357363 Ga0068860_1003573632 138
841 3300006175 Ga0070712_100263917 Ga0070712_1002639172 138
842 3300006237 Ga0097621_100298852 Ga0097621_1002988522 138
843 3300006852 Ga0075433_10213554 Ga0075433_102135542 138
844 3300006931 Ga0097620_100495613 Ga0097620_1004956131 138
845 3300009094 Ga0111539_10145942 Ga0111539_101459423 138
846 3300009098 Ga0105245_10712698 Ga0105245_107126982 138
847 3300009176 Ga0105242_11044514 Ga0105242_110445142 138
848 3300009177 Ga0105248_12791604 Ga0105248_127916041 138
849 3300009551 Ga0105238_11116781 Ga0105238_111167812 138
850 3300010375 Ga0105239_10335619 Ga0105239_103356192 138
851 3300013102 Ga0157371_10432281 Ga0157371_104322812 138
852 3300013296 Ga0157374_10031470 Ga0157374_100314705 138
853 3300013297 Ga0157378_10174802 Ga0157378_101748022 138
854 3300013297 Ga0157378_11194211 Ga0157378_111942112 138
855 3300013306 Ga0163162_10667578 Ga0163162_106675782 138
856 3300013308 Ga0157375_10643790 Ga0157375_106437902 138
857 3300013308 Ga0157375_10761348 Ga0157375_107613482 138
858 3300014325 Ga0163163_10135171 Ga0163163_101351712 138
859 3300014326 Ga0157380_11681799 Ga0157380_116817992 138
860 3300014968 Ga0157379_10024000 Ga0157379_100240006 138
861 3300025315 Ga0207697_10000360 Ga0207697_1000036016 138
862 3300025321 Ga0207656_10077866 Ga0207656_100778662 138
863 3300025893 Ga0207682_10006100 Ga0207682_100061002 138
864 3300025900 Ga0207710_10179851 Ga0207710_101798512 138
865 3300025901 Ga0207688_10079044 Ga0207688_100790442 138
866 3300025903 Ga0207680_10024743 Ga0207680_100247433 138
867 3300025904 Ga0207647_10129115 Ga0207647_101291152 138
868 3300025907 Ga0207645_10027029 Ga0207645_100270292 138
869 3300025908 Ga0207643_10017612 Ga0207643_100176122 138
870 3300025909 Ga0207705_10359524 Ga0207705_103595242 138
871 3300025916 Ga0207663_10383846 Ga0207663_103838462 138
872 3300025925 Ga0207650_10022832 Ga0207650_100228323 138
873 3300025925 Ga0207650_10395882 Ga0207650_103958822 138
874 3300025925 Ga0207650_10669006 Ga0207650_106690062 138
875 3300025926 Ga0207659_10021592 Ga0207659_100215923 138
876 3300025931 Ga0207644_10040410 Ga0207644_100404103 138
877 3300025931 Ga0207644_10162762 Ga0207644_101627622 138
878 3300025933 Ga0207706_10012830 Ga0207706_100128302 138
879 3300025936 Ga0207670_10219591 Ga0207670_102195912 138
880 3300025937 Ga0207669_10775292 Ga0207669_107752921 138
881 3300025942 Ga0207689_10004467 Ga0207689_100044672 138
882 3300025960 Ga0207651_10026315 Ga0207651_100263152 138
883 3300025972 Ga0207668_11024298 Ga0207668_110242981 138
884 3300025981 Ga0207640_10165360 Ga0207640_101653602 138
885 3300025986 Ga0207658_10029445 Ga0207658_100294452 138
886 3300026041 Ga0207639_10111377 Ga0207639_101113772 138
887 3300026067 Ga0207678_10021501 Ga0207678_100215014 138
888 3300026075 Ga0207708_10033311 Ga0207708_100333112 138
889 3300026088 Ga0207641_10714416 Ga0207641_107144162 138
890 3300026095 Ga0207676_10072191 Ga0207676_100721913 138
891 3300026118 Ga0207675_100060906 Ga0207675_1000609063 138
892 3300026118 Ga0207675_102048160 Ga0207675_1020481601 138
893 3300026121 Ga0207683_10073734 Ga0207683_100737342 138
894 3300026142 Ga0207698_12022826 Ga0207698_120228261 138
895 3300027907 Ga0207428_10169034 Ga0207428_101690342 138
896 3300028379 Ga0268266_10206360 Ga0268266_102063602 138
897 3300028380 Ga0268265_11691714 Ga0268265_116917142 138
898 3300028380 Ga0268265_11807600 Ga0268265_118076002 138
899 3300028381 Ga0268264_11086251 Ga0268264_110862511 138
900 3300035113 Ga0373936_0187313 Ga0373936_0187313_59_505 138
901 3300035117 Ga0373953_0102572 Ga0373953_0102572_207_653 138
902 3300035120 Ga0373957_0193475 Ga0373957_0193475_116_562 138
903 3300035170 Ga0373943_0149775 Ga0373943_0149775_267_686 138
904 3300036401 Ga0373937_0227890 Ga0373937_0227890_960_1406 138
905 3300036401 Ga0373937_1334621 Ga0373937_1334621_21_470 138
906 3300037068 Ga0373925_0297836 Ga0373925_0297836_149_568 138
907 3300046459 Ga0495629_0103059 Ga0495629_0103059_433_879 138
908 3300046473 Ga0495582_0279941 Ga0495582_0279941_430_876 138
909 3300046537 Ga0495598_0053991 Ga0495598_0053991_69_488 138
910 3300048903 Ga0496100_0695657 Ga0496100_0695657_62_481 138
911 3300048904 Ga0496101_0088711 Ga0496101_0088711_118_537 138
912 3300048905 Ga0496102_0646923 Ga0496102_0646923_252_671 138
913 3300048908 Ga0496105_0415100 Ga0496105_0415100_187_606 138
914 3300048909 Ga0496106_0147370 Ga0496106_0147370_848_1267 138
915 3300048910 Ga0496107_0835605 Ga0496107_0835605_24_443 138
916 3300048911 Ga0496108_0336445 Ga0496108_0336445_42_503 138
917 3300048912 Ga0496109_0021470 Ga0496109_0021470_2695_3114 138
918 3300048913 Ga0496110_0036433 Ga0496110_0036433_1325_1744 138
919 3300048914 Ga0496111_0028854 Ga0496111_0028854_2782_3201 138
920 3300048915 Ga0496112_1193646 Ga0496112_1193646_180_599 138
921 3300048916 Ga0496113_0150584 Ga0496113_0150584_1260_1679 138
922 3300048917 Ga0496114_0022176 Ga0496114_0022176_875_1291 138
923 3300050511 nmdc:mga08y16_240342_c1 nmdc:mga08y16_240342_c1_446_862 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

41

116

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oqr-assembly2.cif.gz_B crystal structure of the s. pombe condensin cnd3-cnd2 subcomplex 0.6377 70 111
1vke-assembly1.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution 0.6237 43 135
1vke-assembly1.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution 0.5981 43 135
1p8c-assembly1.cif.gz_A crystal structure of tm1620 (apc4843) from thermotoga maritima 0.5974 37 135
1p8c-assembly1.cif.gz_B crystal structure of tm1620 (apc4843) from thermotoga maritima 0.5811 37 135
ID Description Score Start End Superfamily
1vkeB00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.6604 47 136 1.20.1290.10
af_Q12387_3_540_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.656 60 111 1.25.40.10
1vkeC00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.6323 47 136 1.20.1290.10
1vkeF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.6237 43 135 1.20.1290.10
2fmmE00 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain 0.6012 66 125 1.10.1240.40
ID Description Score Start End GO Terms
AF-A0A2E3AEC0-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.7559 63 135 GO:0051920
AF-A0A3D8VP84-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.7467 63 137 GO:0051920
AF-A0A285M3X4-F1-model_v4 4-carboxymuconolactone decarboxylase 0.7109 63 138 GO:0051920
AF-A0A0F9N9R3-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.7024 63 138 GO:0051920
AF-A0A0Q8B596-F1-model_v4 Uncharacterized protein 0.6806 63 133

Feature Viewer

pLDDT pTM Quality
71.77 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map