F478386

General Info

Members Datasets Scaffolds Average Seq Length
738 288 1476 112

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_12246288|Ga0157374_122462881
Length 129
Sequence MSGQPGGHATAEIEEETVMPEDLASQTCAPCRGGTPPLKGAELRSIQQKVPQWKVVNEHHITRAFAFPDFKQALDFVNRVGEVAEQQGHHPDILLTWGKAEITMWTHKIDGLTQSDFIMAAKIDKLLPS

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
134 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
212 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 1.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.18
Rhizosphere 92.55
Stem 0
Stem Tuber 0
Unclassified 27.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_12246288 3300013296 Unclassified 573
2 MBSR1b_contig_9582295 2162886012 Bacteria 1444
3 JGI24752J21851_1000331 3300001976 Bacteria 6590
4 JGI24747J21853_1049202 3300001978 Unclassified 511
5 JGI24737J22298_10028557 3300001990 Bacteria 1753
6 JGI24743J22301_10000093 3300001991 Bacteria 8658
7 JGI24745J21846_1013893 3300002073 Bacteria 930
8 JGI24748J21848_1009443 3300002074 Bacteria 1149
9 JGI24738J21930_10157838 3300002075 Unclassified 507
10 JGI24033J26618_1004020 3300002155 Bacteria 1573
11 JGI24034J26672_10000810 3300002239 Unclassified 4051
12 JGI24751J29686_10000635 3300002459 Bacteria 9014
13 Ga0058863_11769502 3300004799 Unclassified 1080
14 Ga0058862_10008808 3300004803 Unclassified 625
15 Ga0065712_10169285 3300005290 Bacteria 1253
16 Ga0065715_10002672 3300005293 Unclassified 4564
17 Ga0065715_10408013 3300005293 Bacteria 837
18 Ga0070658_10091494 3300005327 Unclassified 2507
19 Ga0070658_10370542 3300005327 Bacteria 1228
20 Ga0070658_10405901 3300005327 Bacteria 1171
21 Ga0070658_10415299 3300005327 Bacteria 1157
22 Ga0070676_10005283 3300005328 Bacteria 6866
23 Ga0070676_10160666 3300005328 Bacteria 1446
24 Ga0070683_100001910 3300005329 Bacteria 16302
25 Ga0070683_100021957 3300005329 Bacteria 5698
26 Ga0070683_100031689 3300005329 Bacteria 4811
27 Ga0070683_100082482 3300005329 Bacteria 3011
28 Ga0070690_100003363 3300005330 Bacteria 8732
29 Ga0070690_100145461 3300005330 Bacteria 1612
30 Ga0070690_100147599 3300005330 Bacteria 1602
31 Ga0070690_100888145 3300005330 Unclassified 696
32 Ga0070670_100001939 3300005331 Bacteria 16933
33 Ga0070670_100126500 3300005331 Unclassified 2206
34 Ga0070670_101075184 3300005331 Unclassified 733
35 Ga0070677_10003715 3300005333 Unclassified 4938
36 Ga0068869_100052848 3300005334 Unclassified 2951
37 Ga0068869_100490673 3300005334 Unclassified 1024
38 Ga0070666_10008180 3300005335 Bacteria 6481
39 Ga0070666_10011983 3300005335 Bacteria 5456
40 Ga0070680_100089047 3300005336 Unclassified 2554
41 Ga0070682_100003286 3300005337 Bacteria 8968
42 Ga0070682_100071298 3300005337 Bacteria 2223
43 Ga0070682_100209862 3300005337 Unclassified 1379
44 Ga0068868_100008382 3300005338 Bacteria 7398
45 Ga0068868_100010214 3300005338 Bacteria 6786
46 Ga0068868_100037793 3300005338 Unclassified 3744
47 Ga0068868_100106830 3300005338 Unclassified 2271
48 Ga0068868_100345696 3300005338 Bacteria 1273
49 Ga0068868_101727857 3300005338 Unclassified 590
50 Ga0070660_100044330 3300005339 Bacteria 3401
51 Ga0070660_100057478 3300005339 Bacteria 3013
52 Ga0070660_100061610 3300005339 Unclassified 2913
53 Ga0070689_100001082 3300005340 Bacteria 17081
54 Ga0070689_100277665 3300005340 Bacteria 1389
55 Ga0070687_100886103 3300005343 Bacteria 639
56 Ga0070661_100009221 3300005344 Bacteria 6822
57 Ga0070661_100033165 3300005344 Bacteria 3740
58 Ga0070661_100107608 3300005344 Bacteria 2079
59 Ga0070661_100162808 3300005344 Bacteria 1690
60 Ga0070668_100055194 3300005347 Bacteria 3066
61 Ga0070668_100635676 3300005347 Bacteria 937
62 Ga0070669_100001365 3300005353 Bacteria 17595
63 Ga0070675_100219209 3300005354 Bacteria 1656
64 Ga0070671_100106068 3300005355 Unclassified 2358
65 Ga0070674_100158283 3300005356 Bacteria 1716
66 Ga0070673_100009008 3300005364 Bacteria 6679
67 Ga0070673_100153144 3300005364 Bacteria 1954
68 Ga0070688_100000289 3300005365 Bacteria 25802
69 Ga0070659_100002441 3300005366 Bacteria 13204
70 Ga0070659_100014097 3300005366 Bacteria 5966
71 Ga0070667_100144235 3300005367 Unclassified 2087
72 Ga0070667_100278847 3300005367 Bacteria 1500
73 Ga0070709_10052109 3300005434 Bacteria 2570
74 Ga0070709_10064095 3300005434 Bacteria 2349
75 Ga0070709_10181912 3300005434 Unclassified 1477
76 Ga0070709_10205448 3300005434 Bacteria 1397
77 Ga0070709_10395508 3300005434 Unclassified 1031
78 Ga0070714_100025598 3300005435 Bacteria 4870
79 Ga0070714_100658023 3300005435 Bacteria 1009
80 Ga0070714_100945325 3300005435 Unclassified 838
81 Ga0070714_102337374 3300005435 Unclassified 520
82 Ga0070713_100005444 3300005436 Bacteria 8699
83 Ga0070713_100019826 3300005436 Bacteria 5146
84 Ga0070713_100054319 3300005436 Bacteria 3323
85 Ga0070713_100086907 3300005436 Archaea 2682
86 Ga0070713_100121506 3300005436 Unclassified 2291
87 Ga0070713_100384492 3300005436 Unclassified 1308
88 Ga0070713_100923606 3300005436 Bacteria 840
89 Ga0070710_10008104 3300005437 Bacteria 5108
90 Ga0070710_10273287 3300005437 Bacteria 1094
91 Ga0070710_10312298 3300005437 Bacteria 1029
92 Ga0070701_10884135 3300005438 Bacteria 616
93 Ga0070711_100002248 3300005439 Bacteria 10959
94 Ga0070711_100129574 3300005439 Bacteria 1877
95 Ga0070711_100307198 3300005439 Bacteria 1263
96 Ga0070711_100351526 3300005439 Bacteria 1185
97 Ga0070711_101634368 3300005439 Bacteria 564
98 Ga0070700_100196077 3300005441 Bacteria 1415
99 Ga0070694_100083271 3300005444 Bacteria 2229
100 Ga0070694_100354565 3300005444 Bacteria 1137
101 Ga0070708_100059755 3300005445 Bacteria 3399
102 Ga0070663_100010379 3300005455 Bacteria 5805
103 Ga0070663_100063087 3300005455 Bacteria 2674
104 Ga0070663_100926013 3300005455 Bacteria 754
105 Ga0070678_100002783 3300005456 Bacteria 9666
106 Ga0070662_100002426 3300005457 Bacteria 11463
107 Ga0070662_100004251 3300005457 Bacteria 9028
108 Ga0070662_100352213 3300005457 Bacteria 1206
109 Ga0070681_10000316 3300005458 Bacteria 39260
110 Ga0070681_10021618 3300005458 Bacteria 6450
111 Ga0070681_10293479 3300005458 Bacteria 1536
112 Ga0070681_10293697 3300005458 Bacteria 1535
113 Ga0068867_100000749 3300005459 Bacteria 21787
114 Ga0068867_100073669 3300005459 Bacteria 2557
115 Ga0068867_100110748 3300005459 Bacteria 2109
116 Ga0068867_100462299 3300005459 Bacteria 1084
117 Ga0070685_10001601 3300005466 Bacteria 11932
118 Ga0070706_100002695 3300005467 Bacteria 17776
119 Ga0070707_100291810 3300005468 Bacteria 1585
120 Ga0070707_101935803 3300005468 Unclassified 557
121 Ga0070699_100001799 3300005518 Bacteria 19484
122 Ga0070699_100004056 3300005518 Bacteria 12944
123 Ga0070679_100069763 3300005530 Unclassified 3506
124 Ga0070679_100095462 3300005530 Bacteria 2961
125 Ga0070679_101621425 3300005530 Bacteria 595
126 Ga0070684_100001382 3300005535 Bacteria 17441
127 Ga0070684_100007536 3300005535 Bacteria 8472
128 Ga0070684_100035675 3300005535 Bacteria 4258
129 Ga0070684_100162037 3300005535 Bacteria 2029
130 Ga0070697_100006755 3300005536 Bacteria 8898
131 Ga0070697_100011980 3300005536 Bacteria 6787
132 Ga0070697_100044001 3300005536 Bacteria 3616
133 Ga0070697_101039472 3300005536 Unclassified 728
134 Ga0068853_100004139 3300005539 Bacteria 11180
135 Ga0068853_100028987 3300005539 Unclassified 4661
136 Ga0068853_100038223 3300005539 Bacteria 4087
137 Ga0068853_100067230 3300005539 Bacteria 3113
138 Ga0068853_100104817 3300005539 Bacteria 2504
139 Ga0070672_100002640 3300005543 Bacteria 11462
140 Ga0070686_100009767 3300005544 Bacteria 5392
141 Ga0070686_100040874 3300005544 Bacteria 2895
142 Ga0070695_100240649 3300005545 Bacteria 1313
143 Ga0070695_100547240 3300005545 Bacteria 902
144 Ga0070695_100664145 3300005545 Bacteria 824
145 Ga0070696_100208070 3300005546 Bacteria 1463
146 Ga0070696_100343277 3300005546 Bacteria 1154
147 Ga0070693_100007116 3300005547 Bacteria 5455
148 Ga0070693_100038385 3300005547 Bacteria 2676
149 Ga0070665_100029285 3300005548 Bacteria 5542
150 Ga0070665_100069445 3300005548 Unclassified 3531
151 Ga0070665_100610923 3300005548 Bacteria 1103
152 Ga0070665_100698832 3300005548 Bacteria 1027
153 Ga0070704_100175269 3300005549 Bacteria 1710
154 Ga0070704_101460233 3300005549 Unclassified 628
155 Ga0068855_100000903 3300005563 Bacteria 36808
156 Ga0068855_100008318 3300005563 Bacteria 12540
157 Ga0068855_100018323 3300005563 Bacteria 8410
158 Ga0068855_100070191 3300005563 Bacteria 4076
159 Ga0068855_100426688 3300005563 Bacteria 1449
160 Ga0068855_101989677 3300005563 Unclassified 587
161 Ga0070664_100006830 3300005564 Bacteria 9204
162 Ga0070664_100020221 3300005564 Bacteria 5481
163 Ga0070664_100103439 3300005564 Bacteria 2479
164 Ga0068857_100002750 3300005577 Bacteria 14452
165 Ga0068857_100006800 3300005577 Bacteria 9846
166 Ga0068857_100015007 3300005577 Bacteria 6759
167 Ga0068857_100183885 3300005577 Bacteria 1902
168 Ga0068857_101723093 3300005577 Unclassified 613
169 Ga0068854_100022350 3300005578 Bacteria 4307
170 Ga0068854_100103379 3300005578 Bacteria 2138
171 Ga0068854_100296632 3300005578 Unclassified 1306
172 Ga0068854_100345535 3300005578 Bacteria 1216
173 Ga0068856_100001036 3300005614 Bacteria 29524
174 Ga0068856_100001068 3300005614 Bacteria 29002
175 Ga0068856_100018327 3300005614 Bacteria 6786
176 Ga0068856_100216334 3300005614 Bacteria 1931
177 Ga0068856_100547126 3300005614 Bacteria 1179
178 Ga0068856_100667995 3300005614 Bacteria 1060
179 Ga0068856_102231514 3300005614 Bacteria 556
180 Ga0070702_100006493 3300005615 Bacteria 5541
181 Ga0070702_100237110 3300005615 Unclassified 1229
182 Ga0068852_100005202 3300005616 Bacteria 9279
183 Ga0068852_100025776 3300005616 Bacteria 4769
184 Ga0068852_100403406 3300005616 Unclassified 1345
185 Ga0068859_100029738 3300005617 Bacteria 5481
186 Ga0068859_100032315 3300005617 Bacteria 5257
187 Ga0068864_100003567 3300005618 Bacteria 12861
188 Ga0068864_100031399 3300005618 Bacteria 4507
189 Ga0068866_10001464 3300005718 Bacteria 10084
190 Ga0068866_10214536 3300005718 Bacteria 1157
191 Ga0068866_10298376 3300005718 Unclassified 1005
192 Ga0068861_100002752 3300005719 Bacteria 11529
193 Ga0068851_10002205 3300005834 Bacteria 8567
194 Ga0068851_10029254 3300005834 Bacteria 2727
195 Ga0068870_10000606 3300005840 Bacteria 13652
196 Ga0068863_100010061 3300005841 Bacteria 9204
197 Ga0068863_100053854 3300005841 Bacteria 3814
198 Ga0068863_100301698 3300005841 Unclassified 1554
199 Ga0068863_100312589 3300005841 Bacteria 1525
200 Ga0068863_102101971 3300005841 Unclassified 575
201 Ga0068858_100005248 3300005842 Bacteria 12695
202 Ga0068858_100021345 3300005842 Bacteria 6049
203 Ga0068858_100062982 3300005842 Unclassified 3430
204 Ga0068858_100070266 3300005842 Bacteria 3245
205 Ga0068858_100964442 3300005842 Bacteria 835
206 Ga0068860_100039000 3300005843 Bacteria 4544
207 Ga0068860_100047365 3300005843 Unclassified 4098
208 Ga0068860_100497156 3300005843 Unclassified 1217
209 Ga0068860_101065769 3300005843 Bacteria 827
210 Ga0068862_100056995 3300005844 Unclassified 3349
211 Ga0068862_100482592 3300005844 Unclassified 1173
212 Ga0070717_10001077 3300006028 Bacteria 18344
213 Ga0070717_10020671 3300006028 Bacteria 5181
214 Ga0070717_10134364 3300006028 Bacteria 2129
215 Ga0070717_11143972 3300006028 Unclassified 709
216 Ga0070715_10010457 3300006163 Unclassified 3308
217 Ga0070715_10016825 3300006163 Bacteria 2756
218 Ga0070715_10102355 3300006163 Bacteria 1338
219 Ga0070716_100026082 3300006173 Unclassified 3126
220 Ga0070716_100058390 3300006173 Bacteria 2220
221 Ga0070716_100060568 3300006173 Bacteria 2187
222 Ga0070716_100074962 3300006173 Bacteria 2001
223 Ga0070716_100109284 3300006173 Bacteria 1710
224 Ga0070716_100147367 3300006173 Bacteria 1509
225 Ga0070716_100290664 3300006173 Bacteria 1132
226 Ga0070716_100451604 3300006173 Unclassified 937
227 Ga0070712_100000566 3300006175 Bacteria 21524
228 Ga0070712_100004100 3300006175 Bacteria 8952
229 Ga0070712_100005444 3300006175 Bacteria 7883
230 Ga0070712_100039310 3300006175 Bacteria 3237
231 Ga0097621_100000216 3300006237 Bacteria 38151
232 Ga0097621_100005019 3300006237 Bacteria 9288
233 Ga0097621_100065896 3300006237 Bacteria 2982
234 Ga0097621_100083411 3300006237 Unclassified 2663
235 Ga0097621_100162180 3300006237 Bacteria 1922
236 Ga0097621_100292566 3300006237 Bacteria 1436
237 Ga0068871_100000182 3300006358 Bacteria 42634
238 Ga0068871_100007539 3300006358 Bacteria 7783
239 Ga0068871_100052698 3300006358 Bacteria 3296
240 Ga0068871_100252176 3300006358 Unclassified 1537
241 Ga0068871_100332071 3300006358 Bacteria 1341
242 Ga0068871_100523629 3300006358 Unclassified 1071
243 Ga0068871_100568285 3300006358 Bacteria 1028
244 Ga0068871_100837450 3300006358 Unclassified 850
245 Ga0075428_101157756 3300006844 Unclassified 816
246 Ga0075433_10117605 3300006852 Unclassified 2359
247 Ga0075433_10530540 3300006852 Unclassified 1035
248 Ga0075433_10997861 3300006852 Unclassified 729
249 Ga0075434_100005505 3300006871 Bacteria 11532
250 Ga0075434_100247864 3300006871 Bacteria 1800
251 Ga0075434_100541282 3300006871 Bacteria 1184
252 Ga0075434_100837917 3300006871 Unclassified 935
253 Ga0068865_100011689 3300006881 Bacteria 5500
254 Ga0068865_100093370 3300006881 Bacteria 2188
255 Ga0068865_100307328 3300006881 Unclassified 1271
256 Ga0075436_100045890 3300006914 Unclassified 3014
257 Ga0075436_100149157 3300006914 Bacteria 1645
258 Ga0075436_101383047 3300006914 Unclassified 533
259 Ga0097620_100029739 3300006931 Bacteria 5481
260 Ga0097620_100032313 3300006931 Bacteria 5257
261 Ga0075435_100092565 3300007076 Bacteria 2497
262 Ga0105250_10611913 3300009092 Unclassified 506
263 Ga0105240_10053308 3300009093 Bacteria 5077
264 Ga0105240_10075293 3300009093 Bacteria 4164
265 Ga0105240_10164065 3300009093 Bacteria 2636
266 Ga0105240_10473020 3300009093 Unclassified 1398
267 Ga0105240_10540673 3300009093 Unclassified 1290
268 Ga0105240_10731093 3300009093 Bacteria 1078
269 Ga0105240_10797934 3300009093 Bacteria 1023
270 Ga0105245_10002797 3300009098 Bacteria 15694
271 Ga0105245_10088679 3300009098 Unclassified 2842
272 Ga0105245_10745329 3300009098 Bacteria 1015
273 Ga0105247_10001769 3300009101 Bacteria 15200
274 Ga0105243_10246974 3300009148 Unclassified 1591
275 Ga0105243_10321931 3300009148 Unclassified 1409
276 Ga0105243_11466350 3300009148 Unclassified 705
277 Ga0105241_10008758 3300009174 Bacteria 7436
278 Ga0105241_10013885 3300009174 Bacteria 5901
279 Ga0105241_10022680 3300009174 Bacteria 4651
280 Ga0105241_10150024 3300009174 Bacteria 1906
281 Ga0105241_10209176 3300009174 Unclassified 1634
282 Ga0105242_10005432 3300009176 Bacteria 9856
283 Ga0105242_10014052 3300009176 Bacteria 6194
284 Ga0105242_10017241 3300009176 Bacteria 5623
285 Ga0105248_10015267 3300009177 Bacteria 8467
286 Ga0105248_10029186 3300009177 Bacteria 6151
287 Ga0105248_10039571 3300009177 Bacteria 5282
288 Ga0105248_10056843 3300009177 Unclassified 4390
289 Ga0105248_10310935 3300009177 Bacteria 1774
290 Ga0105248_11201884 3300009177 Bacteria 857
291 Ga0105237_10022385 3300009545 Bacteria 6485
292 Ga0105237_10030939 3300009545 Bacteria 5430
293 Ga0105237_10061368 3300009545 Unclassified 3759
294 Ga0105237_10278684 3300009545 Unclassified 1675
295 Ga0105237_11135032 3300009545 Unclassified 788
296 Ga0105238_10005296 3300009551 Bacteria 12753
297 Ga0105238_10022710 3300009551 Bacteria 6394
298 Ga0105238_10066624 3300009551 Bacteria 3602
299 Ga0105238_10174097 3300009551 Unclassified 2128
300 Ga0105238_10449343 3300009551 Bacteria 1286
301 Ga0105238_10648251 3300009551 Bacteria 1066
302 Ga0105249_10015359 3300009553 Bacteria 6776
303 Ga0105249_10232384 3300009553 Bacteria 1819
304 Ga0105249_10776029 3300009553 Bacteria 1021
305 Ga0099796_10247869 3300010159 Unclassified 739
306 Ga0105239_10004431 3300010375 Bacteria 16792
307 Ga0105239_10042312 3300010375 Bacteria 4993
308 Ga0105239_10088162 3300010375 Bacteria 3421
309 Ga0105239_10221123 3300010375 Bacteria 2124
310 Ga0105239_10783412 3300010375 Unclassified 1092
311 Ga0105239_10943677 3300010375 Unclassified 991
312 Ga0105246_10002416 3300011119 Bacteria 11268
313 Ga0105246_11074476 3300011119 Unclassified 733
314 Ga0157373_10006047 3300013100 Bacteria 9050
315 Ga0157373_10006948 3300013100 Bacteria 8426
316 Ga0157373_10036993 3300013100 Unclassified 3502
317 Ga0157371_10006502 3300013102 Bacteria 9624
318 Ga0157371_10020814 3300013102 Bacteria 4825
319 Ga0157371_10042811 3300013102 Archaea 3227
320 Ga0157370_10009209 3300013104 Bacteria 10585
321 Ga0157370_10655340 3300013104 Bacteria 959
322 Ga0157370_11643626 3300013104 Unclassified 577
323 Ga0157370_11695722 3300013104 Bacteria 567
324 Ga0157369_10001537 3300013105 Bacteria 28258
325 Ga0157369_10031401 3300013105 Bacteria 5849
326 Ga0157369_10036757 3300013105 Bacteria 5364
327 Ga0157369_11311365 3300013105 Unclassified 738
328 Ga0157369_12651676 3300013105 Unclassified 506
329 Ga0157374_10000090 3300013296 Bacteria 88789
330 Ga0157374_10000483 3300013296 Bacteria 36023
331 Ga0157374_10002984 3300013296 Bacteria 14164
332 Ga0157374_10019060 3300013296 Bacteria 6070
333 Ga0157374_10030042 3300013296 Bacteria 4931
334 Ga0157374_10397741 3300013296 Unclassified 1374
335 Ga0157374_10415739 3300013296 Bacteria 1343
336 Ga0157378_10000331 3300013297 Bacteria 46651
337 Ga0157378_10005420 3300013297 Bacteria 11188
338 Ga0157378_10039250 3300013297 Bacteria 4199
339 Ga0157378_10044277 3300013297 Bacteria 3952
340 Ga0157378_10413535 3300013297 Unclassified 1332
341 Ga0157378_12415544 3300013297 Unclassified 577
342 Ga0163162_10013974 3300013306 Bacteria 7846
343 Ga0163162_10024935 3300013306 Bacteria 5908
344 Ga0163162_10088799 3300013306 Unclassified 3170
345 Ga0163162_10205651 3300013306 Bacteria 2098
346 Ga0163162_10716344 3300013306 Unclassified 1121
347 Ga0163162_10761444 3300013306 Bacteria 1087
348 Ga0157372_10000100 3300013307 Bacteria 89828
349 Ga0157372_10009031 3300013307 Bacteria 10594
350 Ga0157372_10021173 3300013307 Bacteria 7024
351 Ga0157372_10424099 3300013307 Unclassified 1550
352 Ga0157372_11411127 3300013307 Unclassified 803
353 Ga0157372_11528981 3300013307 Unclassified 769
354 Ga0157375_10003505 3300013308 Bacteria 13607
355 Ga0157375_10127795 3300013308 Bacteria 2659
356 Ga0163163_10000958 3300014325 Bacteria 24503
357 Ga0163163_10048270 3300014325 Bacteria 4186
358 Ga0163163_10314893 3300014325 Unclassified 1618
359 Ga0163163_11227269 3300014325 Bacteria 812
360 Ga0157380_10025039 3300014326 Unclassified 4522
361 Ga0182008_10002356 3300014497 Bacteria 11893
362 Ga0157377_10000467 3300014745 Bacteria 17434
363 Ga0157379_10006291 3300014968 Bacteria 10224
364 Ga0157379_10030890 3300014968 Unclassified 4771
365 Ga0157379_10665666 3300014968 Bacteria 975
366 Ga0157376_10006340 3300014969 Bacteria 8355
367 Ga0157376_10135808 3300014969 Unclassified 2201
368 Ga0157376_10178373 3300014969 Bacteria 1940
369 Ga0157376_10346075 3300014969 Unclassified 1421
370 Ga0182006_1023091 3300015261 Unclassified 2577
371 Ga0182007_10004823 3300015262 Bacteria 6040
372 Ga0163161_10038216 3300017792 Unclassified 3443
373 Ga0206350_10233586 3300020080 Bacteria 1443
374 Ga0224712_10295021 3300022467 Unclassified 757
375 Ga0224572_1044419 3300024225 Bacteria 833
376 Ga0228598_1001121 3300024227 Bacteria 5910
377 Ga0207697_10002916 3300025315 Bacteria 8654
378 Ga0207697_10161545 3300025315 Unclassified 977
379 Ga0207656_10051754 3300025321 Bacteria 1776
380 Ga0207696_1086358 3300025711 Bacteria 863
381 Ga0207682_10003786 3300025893 Bacteria 6496
382 Ga0207692_10036336 3300025898 Unclassified 2401
383 Ga0207692_10254732 3300025898 Unclassified 1053
384 Ga0207692_10286658 3300025898 Bacteria 998
385 Ga0207642_10008335 3300025899 Bacteria 3549
386 Ga0207642_10092397 3300025899 Bacteria 1498
387 Ga0207642_11153481 3300025899 Unclassified 502
388 Ga0207710_10003898 3300025900 Bacteria 6589
389 Ga0207688_10000372 3300025901 Bacteria 20907
390 Ga0207680_10010107 3300025903 Unclassified 4709
391 Ga0207680_10082240 3300025903 Bacteria 2026
392 Ga0207647_10008793 3300025904 Bacteria 7209
393 Ga0207647_10460846 3300025904 Archaea 712
394 Ga0207685_10403643 3300025905 Unclassified 701
395 Ga0207699_10002843 3300025906 Bacteria 8200
396 Ga0207699_10052304 3300025906 Bacteria 2417
397 Ga0207699_10139708 3300025906 Bacteria 1591
398 Ga0207699_10144125 3300025906 Bacteria 1568
399 Ga0207699_10201970 3300025906 Unclassified 1347
400 Ga0207699_10321803 3300025906 Unclassified 1085
401 Ga0207645_10000051 3300025907 Bacteria 84255
402 Ga0207645_10018414 3300025907 Bacteria 4594
403 Ga0207643_10000079 3300025908 Bacteria 63366
404 Ga0207705_10030843 3300025909 Unclassified 3826
405 Ga0207705_10473411 3300025909 Bacteria 972
406 Ga0207705_10545501 3300025909 Bacteria 901
407 Ga0207684_10003578 3300025910 Bacteria 15124
408 Ga0207654_10004318 3300025911 Bacteria 7166
409 Ga0207654_10062709 3300025911 Unclassified 2179
410 Ga0207654_10073471 3300025911 Bacteria 2038
411 Ga0207654_10172651 3300025911 Bacteria 1405
412 Ga0207654_10179057 3300025911 Bacteria 1382
413 Ga0207707_10006534 3300025912 Bacteria 10174
414 Ga0207707_10038395 3300025912 Bacteria 4184
415 Ga0207707_10083377 3300025912 Bacteria 2791
416 Ga0207707_10113218 3300025912 Bacteria 2371
417 Ga0207707_10127015 3300025912 Bacteria 2230
418 Ga0207695_10053615 3300025913 Bacteria 4217
419 Ga0207695_10329497 3300025913 Unclassified 1415
420 Ga0207695_10372364 3300025913 Unclassified 1314
421 Ga0207695_10537123 3300025913 Bacteria 1051
422 Ga0207671_10009137 3300025914 Bacteria 8320
423 Ga0207671_10052117 3300025914 Bacteria 3032
424 Ga0207671_10104037 3300025914 Bacteria 2153
425 Ga0207671_10267374 3300025914 Bacteria 1347
426 Ga0207671_10561174 3300025914 Unclassified 910
427 Ga0207693_10003938 3300025915 Bacteria 12624
428 Ga0207693_10004992 3300025915 Bacteria 11129
429 Ga0207693_10005699 3300025915 Bacteria 10352
430 Ga0207693_10044528 3300025915 Unclassified 3488
431 Ga0207663_10022475 3300025916 Bacteria 3605
432 Ga0207663_10074322 3300025916 Bacteria 2202
433 Ga0207663_10406697 3300025916 Bacteria 1042
434 Ga0207663_10461684 3300025916 Bacteria 981
435 Ga0207663_10988548 3300025916 Bacteria 675
436 Ga0207660_10055524 3300025917 Bacteria 2831
437 Ga0207660_10068043 3300025917 Archaea 2582
438 Ga0207662_10355510 3300025918 Bacteria 985
439 Ga0207657_10000246 3300025919 Bacteria 57698
440 Ga0207657_10000292 3300025919 Bacteria 53366
441 Ga0207657_10001266 3300025919 Bacteria 26953
442 Ga0207649_10000242 3300025920 Bacteria 44166
443 Ga0207649_10035420 3300025920 Bacteria 2999
444 Ga0207652_10137235 3300025921 Bacteria 2185
445 Ga0207652_10265697 3300025921 Bacteria 1548
446 Ga0207646_10125198 3300025922 Bacteria 2310
447 Ga0207681_10075318 3300025923 Unclassified 2366
448 Ga0207694_10002864 3300025924 Bacteria 13898
449 Ga0207694_10005754 3300025924 Bacteria 9500
450 Ga0207694_10014163 3300025924 Bacteria 6012
451 Ga0207694_10045721 3300025924 Bacteria 3382
452 Ga0207694_10355243 3300025924 Bacteria 1213
453 Ga0207694_10555289 3300025924 Unclassified 964
454 Ga0207650_10000090 3300025925 Bacteria 118973
455 Ga0207650_11082910 3300025925 Unclassified 682
456 Ga0207659_10002035 3300025926 Bacteria 11997
457 Ga0207687_10002307 3300025927 Bacteria 12991
458 Ga0207687_10013901 3300025927 Bacteria 5260
459 Ga0207687_10329020 3300025927 Unclassified 1239
460 Ga0207700_10000685 3300025928 Bacteria 19728
461 Ga0207700_10004609 3300025928 Bacteria 8159
462 Ga0207700_10090161 3300025928 Unclassified 2419
463 Ga0207700_10118884 3300025928 Unclassified 2139
464 Ga0207700_10330357 3300025928 Bacteria 1323
465 Ga0207700_11250885 3300025928 Unclassified 662
466 Ga0207700_11349304 3300025928 Unclassified 635
467 Ga0207664_10148252 3300025929 Bacteria 1991
468 Ga0207664_10172385 3300025929 Bacteria 1852
469 Ga0207664_10347576 3300025929 Unclassified 1312
470 Ga0207664_10409035 3300025929 Bacteria 1207
471 Ga0207664_10748508 3300025929 Unclassified 879
472 Ga0207644_10002582 3300025931 Bacteria 11652
473 Ga0207690_10003087 3300025932 Bacteria 10034
474 Ga0207690_10022450 3300025932 Unclassified 3927
475 Ga0207690_10169754 3300025932 Bacteria 1633
476 Ga0207690_11575827 3300025932 Unclassified 549
477 Ga0207706_10000139 3300025933 Bacteria 79096
478 Ga0207706_10001055 3300025933 Bacteria 28007
479 Ga0207706_10084476 3300025933 Bacteria 2791
480 Ga0207686_10055788 3300025934 Bacteria 2480
481 Ga0207709_10371488 3300025935 Bacteria 1085
482 Ga0207670_10001693 3300025936 Bacteria 11493
483 Ga0207670_10593248 3300025936 Bacteria 909
484 Ga0207669_11121922 3300025937 Unclassified 664
485 Ga0207704_10020900 3300025938 Unclassified 3474
486 Ga0207704_10027609 3300025938 Bacteria 3136
487 Ga0207704_10291971 3300025938 Unclassified 1245
488 Ga0207665_10015670 3300025939 Unclassified 4975
489 Ga0207665_10074253 3300025939 Unclassified 2327
490 Ga0207665_10082116 3300025939 Bacteria 2220
491 Ga0207665_10091681 3300025939 Bacteria 2107
492 Ga0207665_10098521 3300025939 Bacteria 2037
493 Ga0207665_10099049 3300025939 Bacteria 2032
494 Ga0207665_10112571 3300025939 Bacteria 1914
495 Ga0207665_10498451 3300025939 Unclassified 940
496 Ga0207665_10901943 3300025939 Unclassified 701
497 Ga0207691_10001343 3300025940 Bacteria 24540
498 Ga0207711_10002838 3300025941 Bacteria 15224
499 Ga0207711_10018665 3300025941 Bacteria 5767
500 Ga0207711_10108962 3300025941 Bacteria 2461
501 Ga0207711_11879466 3300025941 Bacteria 542
502 Ga0207689_10000304 3300025942 Bacteria 45071
503 Ga0207689_10773812 3300025942 Unclassified 810
504 Ga0207661_10000583 3300025944 Bacteria 23334
505 Ga0207661_10019113 3300025944 Bacteria 5101
506 Ga0207661_10070730 3300025944 Bacteria 2849
507 Ga0207679_10000184 3300025945 Bacteria 51157
508 Ga0207679_10091753 3300025945 Bacteria 2351
509 Ga0207679_10202751 3300025945 Bacteria 1658
510 Ga0207667_10000170 3300025949 Bacteria 95740
511 Ga0207667_10004029 3300025949 Bacteria 18047
512 Ga0207667_10007225 3300025949 Bacteria 13401
513 Ga0207667_10128304 3300025949 Bacteria 2612
514 Ga0207667_10170718 3300025949 Bacteria 2235
515 Ga0207667_10909583 3300025949 Unclassified 871
516 Ga0207651_10002456 3300025960 Bacteria 8859
517 Ga0207651_10223679 3300025960 Unclassified 1523
518 Ga0207712_10013954 3300025961 Bacteria 5155
519 Ga0207712_10079479 3300025961 Bacteria 2383
520 Ga0207668_10052744 3300025972 Bacteria 2815
521 Ga0207668_10074687 3300025972 Unclassified 2434
522 Ga0207668_10818059 3300025972 Unclassified 825
523 Ga0207640_10022601 3300025981 Bacteria 3767
524 Ga0207640_10049454 3300025981 Bacteria 2722
525 Ga0207640_10067491 3300025981 Bacteria 2394
526 Ga0207640_10115583 3300025981 Bacteria 1911
527 Ga0207658_10001983 3300025986 Bacteria 15269
528 Ga0207658_11442689 3300025986 Bacteria 629
529 Ga0207677_10007606 3300026023 Bacteria 6009
530 Ga0207677_10011702 3300026023 Bacteria 5011
531 Ga0207677_10076939 3300026023 Unclassified 2377
532 Ga0207677_10081360 3300026023 Unclassified 2324
533 Ga0207677_10328926 3300026023 Bacteria 1273
534 Ga0207703_10005260 3300026035 Bacteria 10438
535 Ga0207703_10087059 3300026035 Bacteria 2618
536 Ga0207703_10095986 3300026035 Archaea 2502
537 Ga0207703_10115619 3300026035 Bacteria 2296
538 Ga0207639_10002287 3300026041 Bacteria 12868
539 Ga0207639_10016884 3300026041 Bacteria 5172
540 Ga0207639_10056072 3300026041 Bacteria 3019
541 Ga0207639_10421191 3300026041 Bacteria 1207
542 Ga0207678_10000204 3300026067 Bacteria 52306
543 Ga0207678_10001833 3300026067 Bacteria 19495
544 Ga0207702_10001597 3300026078 Bacteria 22421
545 Ga0207702_10005883 3300026078 Bacteria 10665
546 Ga0207702_10048664 3300026078 Unclassified 3576
547 Ga0207702_10202697 3300026078 Bacteria 1840
548 Ga0207702_10464806 3300026078 Bacteria 1229
549 Ga0207702_10578668 3300026078 Bacteria 1100
550 Ga0207702_11808931 3300026078 Bacteria 603
551 Ga0207702_11990640 3300026078 Unclassified 571
552 Ga0207641_10000894 3300026088 Bacteria 31042
553 Ga0207641_10009428 3300026088 Bacteria 8043
554 Ga0207641_10314118 3300026088 Bacteria 1484
555 Ga0207641_10382005 3300026088 Bacteria 1349
556 Ga0207648_10000757 3300026089 Bacteria 36296
557 Ga0207648_10003612 3300026089 Bacteria 16172
558 Ga0207648_10181375 3300026089 Bacteria 1864
559 Ga0207676_10000113 3300026095 Bacteria 73022
560 Ga0207676_10021492 3300026095 Bacteria 4734
561 Ga0207674_10000076 3300026116 Bacteria 104404
562 Ga0207674_10009505 3300026116 Bacteria 11102
563 Ga0207674_10012344 3300026116 Bacteria 9550
564 Ga0207674_10510987 3300026116 Bacteria 1161
565 Ga0207675_100008819 3300026118 Bacteria 9464
566 Ga0207675_100209346 3300026118 Bacteria 1875
567 Ga0207683_10001129 3300026121 Bacteria 24286
568 Ga0207683_10139318 3300026121 Bacteria 2185
569 Ga0207698_10034814 3300026142 Bacteria 3676
570 Ga0207698_10073362 3300026142 Archaea 2725
571 Ga0207698_10080537 3300026142 Unclassified 2624
572 Ga0207698_10366752 3300026142 Unclassified 1366
573 Ga0207698_10376022 3300026142 Bacteria 1350
574 Ga0265354_1003475 3300028016 Bacteria 1759
575 Ga0268266_10005373 3300028379 Bacteria 11969
576 Ga0268266_10061763 3300028379 Unclassified 3232
577 Ga0268266_10278856 3300028379 Bacteria 1553
578 Ga0268265_10002144 3300028380 Bacteria 15280
579 Ga0268264_10017158 3300028381 Bacteria 5929
580 Ga0268264_10103205 3300028381 Bacteria 2482
581 Ga0268264_10507744 3300028381 Unclassified 1177
582 Ga0265762_1000676 3300030760 Bacteria 6002
583 Ga0265762_1062789 3300030760 Bacteria 766
584 Ga0265770_1008320 3300030878 Bacteria 1477
585 Ga0265770_1117410 3300030878 Bacteria 557
586 Ga0265760_10000206 3300031090 Bacteria 15774
587 Ga0265760_10003560 3300031090 Bacteria 4520
588 Ga0265760_10033288 3300031090 Bacteria 1523
589 Ga0265760_10058278 3300031090 Bacteria 1170
590 Ga0265313_10038348 3300031595 Unclassified 2387
591 Ga0265342_10524984 3300031712 Bacteria 602
592 Ga0373940_0186662 3300035088 Unclassified 676
593 Ga0373940_0323771 3300035088 Unclassified 536
594 Ga0373952_0068054 3300035092 Unclassified 885
595 Ga0373923_0348710 3300035111 Bacteria 707
596 Ga0373923_0612287 3300035111 Unclassified 537
597 Ga0373932_0187903 3300035112 Unclassified 728
598 Ga0373936_0031150 3300035113 Bacteria 2106
599 Ga0373945_0015579 3300035116 Bacteria 2559
600 Ga0373956_0068571 3300035119 Bacteria 1616
601 Ga0373956_0629148 3300035119 Unclassified 512
602 Ga0373946_0461935 3300035171 Bacteria 647
603 Ga0373946_0704577 3300035171 Unclassified 528
604 Ga0373955_0551014 3300035172 Unclassified 705
605 Ga0373961_0273698 3300035241 Unclassified 617
606 Ga0373931_0068842 3300035691 Bacteria 1927
607 Ga0373931_0164848 3300035691 Bacteria 1301
608 Ga0373931_0179118 3300035691 Bacteria 1254
609 Ga0373935_0342165 3300035692 Bacteria 1065
610 Ga0373927_0443442 3300035695 Bacteria 857
611 Ga0373933_0111032 3300035724 Bacteria 1710
612 Ga0373933_0692894 3300035724 Bacteria 670
613 Ga0373947_0064565 3300035725 Bacteria 2232
614 Ga0373947_0383275 3300035725 Bacteria 947
615 Ga0373937_0006928 3300036401 Bacteria 9786
616 Ga0373937_0785266 3300036401 Bacteria 900
617 Ga0373937_1618714 3300036401 Unclassified 595
618 Ga0373925_0087337 3300037068 Bacteria 2380
619 Ga0373925_0493020 3300037068 Unclassified 1005
620 Ga0436363_0942494 3300039450 Bacteria 566
621 Ga0451839_0698791 3300041496 Unclassified 581
622 Ga0451576_1282436 3300045051 Unclassified 764
623 Ga0495592_0146182 3300046454 Bacteria 1639
624 Ga0495651_0448419 3300046462 Bacteria 834
625 Ga0495653_0178202 3300046463 Bacteria 1461
626 Ga0495580_0702637 3300046472 Unclassified 662
627 Ga0495662_0340690 3300046476 Unclassified 737
628 Ga0495662_0674788 3300046476 Unclassified 504
629 Ga0495664_0017250 3300046477 Bacteria 4126
630 Ga0495664_0131284 3300046477 Bacteria 1517
631 Ga0495608_0037373 3300046511 Bacteria 3265
632 Ga0495618_0203085 3300046514 Bacteria 1254
633 Ga0495628_0757193 3300046516 Unclassified 682
634 Ga0495630_0084986 3300046517 Bacteria 2389
635 Ga0495630_0121352 3300046517 Bacteria 1983
636 Ga0495642_0275056 3300046528 Unclassified 737
637 Ga0495652_0517785 3300046529 Bacteria 825
638 Ga0495640_0361501 3300046533 Bacteria 895
639 Ga0495640_0411852 3300046533 Unclassified 829
640 Ga0495587_0067745 3300046536 Bacteria 2080
641 Ga0495645_0005114 3300046543 Bacteria 8987
642 Ga0495645_0296977 3300046543 Bacteria 1057
643 Ga0495667_0016821 3300046559 Bacteria 4938
644 Ga0495667_0330784 3300046559 Unclassified 964
645 Ga0495635_0139099 3300046663 Bacteria 1654
646 Ga0495635_0512669 3300046663 Bacteria 789
647 Ga0495657_0057793 3300046675 Bacteria 2578
648 Ga0495599_0023481 3300046678 Bacteria 3856
649 Ga0495623_0121806 3300046679 Bacteria 1569
650 Ga0495623_0535569 3300046679 Bacteria 615
651 Ga0495646_0029962 3300046680 Bacteria 3399
652 Ga0495669_0270201 3300046684 Unclassified 817
653 Ga0495669_0463321 3300046684 Unclassified 616
654 Ga0495589_0496529 3300046794 Unclassified 557
655 Ga0495600_0224293 3300046809 Unclassified 1202
656 Ga0495604_0047356 3300047317 Bacteria 3348
657 Ga0495604_0797291 3300047317 Unclassified 595
658 Ga0495674_0009662 3300047319 Bacteria 9159
659 Ga0495674_0628774 3300047319 Unclassified 848
660 Ga0495680_0349915 3300047322 Bacteria 1029
661 Ga0495684_0051903 3300047471 Bacteria 3129
662 Ga0495684_0320770 3300047471 Bacteria 1108
663 Ga0495602_0000360 3300048088 Bacteria 42505
664 Ga0495602_0188241 3300048088 Bacteria 1585
665 Ga0495602_0427794 3300048088 Bacteria 939
666 Ga0496100_0031661 3300048903 Bacteria 3290
667 Ga0496100_0744742 3300048903 Unclassified 766
668 Ga0496101_0003461 3300048904 Bacteria 9848
669 Ga0496101_0069100 3300048904 Bacteria 2584
670 Ga0496101_0131212 3300048904 Bacteria 1903
671 Ga0496101_0403020 3300048904 Unclassified 1077
672 Ga0496101_0766498 3300048904 Unclassified 761
673 Ga0496102_0000537 3300048905 Bacteria 40994
674 Ga0496102_0034176 3300048905 Unclassified 4573
675 Ga0496102_0042175 3300048905 Unclassified 4135
676 Ga0496102_0084755 3300048905 Unclassified 2925
677 Ga0496103_0029061 3300048906 Bacteria 3358
678 Ga0496103_0087374 3300048906 Bacteria 1965
679 Ga0496103_0908958 3300048906 Unclassified 551
680 Ga0496104_0043291 3300048907 Bacteria 4229
681 Ga0496104_0043663 3300048907 Bacteria 4210
682 Ga0496104_0097111 3300048907 Unclassified 2819
683 Ga0496104_0193678 3300048907 Bacteria 1945
684 Ga0496104_0622441 3300048907 Unclassified 989
685 Ga0496104_0870699 3300048907 Unclassified 806
686 Ga0496105_0223019 3300048908 Unclassified 1534
687 Ga0496105_0396745 3300048908 Bacteria 1096
688 Ga0496105_0855422 3300048908 Unclassified 688
689 Ga0496106_0060516 3300048909 Bacteria 2871
690 Ga0496106_0137926 3300048909 Bacteria 1917
691 Ga0496106_0167565 3300048909 Bacteria 1740
692 Ga0496106_0844584 3300048909 Unclassified 725
693 Ga0496107_0047707 3300048910 Bacteria 3084
694 Ga0496107_0156443 3300048910 Bacteria 1688
695 Ga0496107_0581475 3300048910 Unclassified 828
696 Ga0496107_0790807 3300048910 Unclassified 695
697 Ga0496108_0002118 3300048911 Bacteria 15901
698 Ga0496109_0000008 3300048912 Bacteria 245809
699 Ga0496109_1163704 3300048912 Bacteria 708
700 Ga0496109_1361679 3300048912 Bacteria 645
701 Ga0496110_0008075 3300048913 Bacteria 8450
702 Ga0496110_0110860 3300048913 Bacteria 2466
703 Ga0496111_0005563 3300048914 Bacteria 8097
704 Ga0496112_0000334 3300048915 Bacteria 30562
705 Ga0496112_0001276 3300048915 Bacteria 19093
706 Ga0496112_0044733 3300048915 Bacteria 4339
707 Ga0496112_0072790 3300048915 Unclassified 3397
708 Ga0496112_0207500 3300048915 Unclassified 1917
709 Ga0496112_0277531 3300048915 Bacteria 1624
710 Ga0496112_0409378 3300048915 Unclassified 1295
711 Ga0496113_0006066 3300048916 Bacteria 7617
712 Ga0496113_0111874 3300048916 Unclassified 2126
713 Ga0496113_0151138 3300048916 Bacteria 1832
714 Ga0496113_0267616 3300048916 Archaea 1366
715 Ga0496114_0041204 3300048917 Bacteria 3826
716 Ga0496115_0016349 3300048918 Bacteria 5648
717 Ga0496115_0446328 3300048918 Unclassified 1045
718 Ga0496115_0629328 3300048918 Unclassified 850
719 Ga0501047_0894319 3300049581 Unclassified 701
720 Ga0501073_0258869 3300049589 Bacteria 1201
721 Ga0501044_0158399 3300049823 Bacteria 2242
722 nmdc:mga08y16_1200968_c1 3300050511 Unclassified 729
723 nmdc:mga0n895_34675_c1 3300050512 Bacteria 4860
724 nmdc:mga0n895_634_c1 3300050512 Bacteria 24414
725 nmdc:mga0rr50_711970_c1 3300050513 Unclassified 857
726 nmdc:mga08x19_1121820_c1 3300050514 Unclassified 558
727 nmdc:mga08x19_12628_c1 3300050514 Bacteria 5093
728 nmdc:mga08x19_168254_c1 3300050514 Bacteria 1491
729 nmdc:mga0a205_117991_c1 3300050515 Bacteria 2552
730 nmdc:mga0a205_493545_c1 3300050515 Unclassified 1082
731 nmdc:mga0a205_905760_c1 3300050515 Unclassified 729
732 Ga0495601_0060993 3300053077 Bacteria 2394
733 Ga0495601_0161914 3300053077 Bacteria 1462
734 Ga0495612_0005112 3300053078 Bacteria 5424
735 Ga0495612_0521841 3300053078 Unclassified 546
736 Ga0495595_0072005 3300053084 Unclassified 1635
737 Ga0495619_0358892 3300053085 Unclassified 1008
738 Ga0587077_191670 3300059493 Bacteria 560
739 Ga0157374_12246288
740 MBSR1b_contig_9582295
741 JGI24752J21851_1000331
742 JGI24747J21853_1049202
743 JGI24737J22298_10028557
744 JGI24743J22301_10000093
745 JGI24745J21846_1013893
746 JGI24748J21848_1009443
747 JGI24738J21930_10157838
748 JGI24033J26618_1004020
749 JGI24034J26672_10000810
750 JGI24751J29686_10000635
751 Ga0058863_11769502
752 Ga0058862_10008808
753 Ga0065712_10169285
754 Ga0065715_10002672
755 Ga0065715_10408013
756 Ga0070658_10091494
757 Ga0070658_10370542
758 Ga0070658_10405901
759 Ga0070658_10415299
760 Ga0070676_10005283
761 Ga0070676_10160666
762 Ga0070683_100001910
763 Ga0070683_100021957
764 Ga0070683_100031689
765 Ga0070683_100082482
766 Ga0070690_100003363
767 Ga0070690_100145461
768 Ga0070690_100147599
769 Ga0070690_100888145
770 Ga0070670_100001939
771 Ga0070670_100126500
772 Ga0070670_101075184
773 Ga0070677_10003715
774 Ga0068869_100052848
775 Ga0068869_100490673
776 Ga0070666_10008180
777 Ga0070666_10011983
778 Ga0070680_100089047
779 Ga0070682_100003286
780 Ga0070682_100071298
781 Ga0070682_100209862
782 Ga0068868_100008382
783 Ga0068868_100010214
784 Ga0068868_100037793
785 Ga0068868_100106830
786 Ga0068868_100345696
787 Ga0068868_101727857
788 Ga0070660_100044330
789 Ga0070660_100057478
790 Ga0070660_100061610
791 Ga0070689_100001082
792 Ga0070689_100277665
793 Ga0070687_100886103
794 Ga0070661_100009221
795 Ga0070661_100033165
796 Ga0070661_100107608
797 Ga0070661_100162808
798 Ga0070668_100055194
799 Ga0070668_100635676
800 Ga0070669_100001365
801 Ga0070675_100219209
802 Ga0070671_100106068
803 Ga0070674_100158283
804 Ga0070673_100009008
805 Ga0070673_100153144
806 Ga0070688_100000289
807 Ga0070659_100002441
808 Ga0070659_100014097
809 Ga0070667_100144235
810 Ga0070667_100278847
811 Ga0070709_10052109
812 Ga0070709_10064095
813 Ga0070709_10181912
814 Ga0070709_10205448
815 Ga0070709_10395508
816 Ga0070714_100025598
817 Ga0070714_100658023
818 Ga0070714_100945325
819 Ga0070714_102337374
820 Ga0070713_100005444
821 Ga0070713_100019826
822 Ga0070713_100054319
823 Ga0070713_100086907
824 Ga0070713_100121506
825 Ga0070713_100384492
826 Ga0070713_100923606
827 Ga0070710_10008104
828 Ga0070710_10273287
829 Ga0070710_10312298
830 Ga0070701_10884135
831 Ga0070711_100002248
832 Ga0070711_100129574
833 Ga0070711_100307198
834 Ga0070711_100351526
835 Ga0070711_101634368
836 Ga0070700_100196077
837 Ga0070694_100083271
838 Ga0070694_100354565
839 Ga0070708_100059755
840 Ga0070663_100010379
841 Ga0070663_100063087
842 Ga0070663_100926013
843 Ga0070678_100002783
844 Ga0070662_100002426
845 Ga0070662_100004251
846 Ga0070662_100352213
847 Ga0070681_10000316
848 Ga0070681_10021618
849 Ga0070681_10293479
850 Ga0070681_10293697
851 Ga0068867_100000749
852 Ga0068867_100073669
853 Ga0068867_100110748
854 Ga0068867_100462299
855 Ga0070685_10001601
856 Ga0070706_100002695
857 Ga0070707_100291810
858 Ga0070707_101935803
859 Ga0070699_100001799
860 Ga0070699_100004056
861 Ga0070679_100069763
862 Ga0070679_100095462
863 Ga0070679_101621425
864 Ga0070684_100001382
865 Ga0070684_100007536
866 Ga0070684_100035675
867 Ga0070684_100162037
868 Ga0070697_100006755
869 Ga0070697_100011980
870 Ga0070697_100044001
871 Ga0070697_101039472
872 Ga0068853_100004139
873 Ga0068853_100028987
874 Ga0068853_100038223
875 Ga0068853_100067230
876 Ga0068853_100104817
877 Ga0070672_100002640
878 Ga0070686_100009767
879 Ga0070686_100040874
880 Ga0070695_100240649
881 Ga0070695_100547240
882 Ga0070695_100664145
883 Ga0070696_100208070
884 Ga0070696_100343277
885 Ga0070693_100007116
886 Ga0070693_100038385
887 Ga0070665_100029285
888 Ga0070665_100069445
889 Ga0070665_100610923
890 Ga0070665_100698832
891 Ga0070704_100175269
892 Ga0070704_101460233
893 Ga0068855_100000903
894 Ga0068855_100008318
895 Ga0068855_100018323
896 Ga0068855_100070191
897 Ga0068855_100426688
898 Ga0068855_101989677
899 Ga0070664_100006830
900 Ga0070664_100020221
901 Ga0070664_100103439
902 Ga0068857_100002750
903 Ga0068857_100006800
904 Ga0068857_100015007
905 Ga0068857_100183885
906 Ga0068857_101723093
907 Ga0068854_100022350
908 Ga0068854_100103379
909 Ga0068854_100296632
910 Ga0068854_100345535
911 Ga0068856_100001036
912 Ga0068856_100001068
913 Ga0068856_100018327
914 Ga0068856_100216334
915 Ga0068856_100547126
916 Ga0068856_100667995
917 Ga0068856_102231514
918 Ga0070702_100006493
919 Ga0070702_100237110
920 Ga0068852_100005202
921 Ga0068852_100025776
922 Ga0068852_100403406
923 Ga0068859_100029738
924 Ga0068859_100032315
925 Ga0068864_100003567
926 Ga0068864_100031399
927 Ga0068866_10001464
928 Ga0068866_10214536
929 Ga0068866_10298376
930 Ga0068861_100002752
931 Ga0068851_10002205
932 Ga0068851_10029254
933 Ga0068870_10000606
934 Ga0068863_100010061
935 Ga0068863_100053854
936 Ga0068863_100301698
937 Ga0068863_100312589
938 Ga0068863_102101971
939 Ga0068858_100005248
940 Ga0068858_100021345
941 Ga0068858_100062982
942 Ga0068858_100070266
943 Ga0068858_100964442
944 Ga0068860_100039000
945 Ga0068860_100047365
946 Ga0068860_100497156
947 Ga0068860_101065769
948 Ga0068862_100056995
949 Ga0068862_100482592
950 Ga0070717_10001077
951 Ga0070717_10020671
952 Ga0070717_10134364
953 Ga0070717_11143972
954 Ga0070715_10010457
955 Ga0070715_10016825
956 Ga0070715_10102355
957 Ga0070716_100026082
958 Ga0070716_100058390
959 Ga0070716_100060568
960 Ga0070716_100074962
961 Ga0070716_100109284
962 Ga0070716_100147367
963 Ga0070716_100290664
964 Ga0070716_100451604
965 Ga0070712_100000566
966 Ga0070712_100004100
967 Ga0070712_100005444
968 Ga0070712_100039310
969 Ga0097621_100000216
970 Ga0097621_100005019
971 Ga0097621_100065896
972 Ga0097621_100083411
973 Ga0097621_100162180
974 Ga0097621_100292566
975 Ga0068871_100000182
976 Ga0068871_100007539
977 Ga0068871_100052698
978 Ga0068871_100252176
979 Ga0068871_100332071
980 Ga0068871_100523629
981 Ga0068871_100568285
982 Ga0068871_100837450
983 Ga0075428_101157756
984 Ga0075433_10117605
985 Ga0075433_10530540
986 Ga0075433_10997861
987 Ga0075434_100005505
988 Ga0075434_100247864
989 Ga0075434_100541282
990 Ga0075434_100837917
991 Ga0068865_100011689
992 Ga0068865_100093370
993 Ga0068865_100307328
994 Ga0075436_100045890
995 Ga0075436_100149157
996 Ga0075436_101383047
997 Ga0097620_100029739
998 Ga0097620_100032313
999 Ga0075435_100092565
1000 Ga0105250_10611913
1001 Ga0105240_10053308
1002 Ga0105240_10075293
1003 Ga0105240_10164065
1004 Ga0105240_10473020
1005 Ga0105240_10540673
1006 Ga0105240_10731093
1007 Ga0105240_10797934
1008 Ga0105245_10002797
1009 Ga0105245_10088679
1010 Ga0105245_10745329
1011 Ga0105247_10001769
1012 Ga0105243_10246974
1013 Ga0105243_10321931
1014 Ga0105243_11466350
1015 Ga0105241_10008758
1016 Ga0105241_10013885
1017 Ga0105241_10022680
1018 Ga0105241_10150024
1019 Ga0105241_10209176
1020 Ga0105242_10005432
1021 Ga0105242_10014052
1022 Ga0105242_10017241
1023 Ga0105248_10015267
1024 Ga0105248_10029186
1025 Ga0105248_10039571
1026 Ga0105248_10056843
1027 Ga0105248_10310935
1028 Ga0105248_11201884
1029 Ga0105237_10022385
1030 Ga0105237_10030939
1031 Ga0105237_10061368
1032 Ga0105237_10278684
1033 Ga0105237_11135032
1034 Ga0105238_10005296
1035 Ga0105238_10022710
1036 Ga0105238_10066624
1037 Ga0105238_10174097
1038 Ga0105238_10449343
1039 Ga0105238_10648251
1040 Ga0105249_10015359
1041 Ga0105249_10232384
1042 Ga0105249_10776029
1043 Ga0099796_10247869
1044 Ga0105239_10004431
1045 Ga0105239_10042312
1046 Ga0105239_10088162
1047 Ga0105239_10221123
1048 Ga0105239_10783412
1049 Ga0105239_10943677
1050 Ga0105246_10002416
1051 Ga0105246_11074476
1052 Ga0157373_10006047
1053 Ga0157373_10006948
1054 Ga0157373_10036993
1055 Ga0157371_10006502
1056 Ga0157371_10020814
1057 Ga0157371_10042811
1058 Ga0157370_10009209
1059 Ga0157370_10655340
1060 Ga0157370_11643626
1061 Ga0157370_11695722
1062 Ga0157369_10001537
1063 Ga0157369_10031401
1064 Ga0157369_10036757
1065 Ga0157369_11311365
1066 Ga0157369_12651676
1067 Ga0157374_10000090
1068 Ga0157374_10000483
1069 Ga0157374_10002984
1070 Ga0157374_10019060
1071 Ga0157374_10030042
1072 Ga0157374_10397741
1073 Ga0157374_10415739
1074 Ga0157378_10000331
1075 Ga0157378_10005420
1076 Ga0157378_10039250
1077 Ga0157378_10044277
1078 Ga0157378_10413535
1079 Ga0157378_12415544
1080 Ga0163162_10013974
1081 Ga0163162_10024935
1082 Ga0163162_10088799
1083 Ga0163162_10205651
1084 Ga0163162_10716344
1085 Ga0163162_10761444
1086 Ga0157372_10000100
1087 Ga0157372_10009031
1088 Ga0157372_10021173
1089 Ga0157372_10424099
1090 Ga0157372_11411127
1091 Ga0157372_11528981
1092 Ga0157375_10003505
1093 Ga0157375_10127795
1094 Ga0163163_10000958
1095 Ga0163163_10048270
1096 Ga0163163_10314893
1097 Ga0163163_11227269
1098 Ga0157380_10025039
1099 Ga0182008_10002356
1100 Ga0157377_10000467
1101 Ga0157379_10006291
1102 Ga0157379_10030890
1103 Ga0157379_10665666
1104 Ga0157376_10006340
1105 Ga0157376_10135808
1106 Ga0157376_10178373
1107 Ga0157376_10346075
1108 Ga0182006_1023091
1109 Ga0182007_10004823
1110 Ga0163161_10038216
1111 Ga0206350_10233586
1112 Ga0224712_10295021
1113 Ga0224572_1044419
1114 Ga0228598_1001121
1115 Ga0207697_10002916
1116 Ga0207697_10161545
1117 Ga0207656_10051754
1118 Ga0207696_1086358
1119 Ga0207682_10003786
1120 Ga0207692_10036336
1121 Ga0207692_10254732
1122 Ga0207692_10286658
1123 Ga0207642_10008335
1124 Ga0207642_10092397
1125 Ga0207642_11153481
1126 Ga0207710_10003898
1127 Ga0207688_10000372
1128 Ga0207680_10010107
1129 Ga0207680_10082240
1130 Ga0207647_10008793
1131 Ga0207647_10460846
1132 Ga0207685_10403643
1133 Ga0207699_10002843
1134 Ga0207699_10052304
1135 Ga0207699_10139708
1136 Ga0207699_10144125
1137 Ga0207699_10201970
1138 Ga0207699_10321803
1139 Ga0207645_10000051
1140 Ga0207645_10018414
1141 Ga0207643_10000079
1142 Ga0207705_10030843
1143 Ga0207705_10473411
1144 Ga0207705_10545501
1145 Ga0207684_10003578
1146 Ga0207654_10004318
1147 Ga0207654_10062709
1148 Ga0207654_10073471
1149 Ga0207654_10172651
1150 Ga0207654_10179057
1151 Ga0207707_10006534
1152 Ga0207707_10038395
1153 Ga0207707_10083377
1154 Ga0207707_10113218
1155 Ga0207707_10127015
1156 Ga0207695_10053615
1157 Ga0207695_10329497
1158 Ga0207695_10372364
1159 Ga0207695_10537123
1160 Ga0207671_10009137
1161 Ga0207671_10052117
1162 Ga0207671_10104037
1163 Ga0207671_10267374
1164 Ga0207671_10561174
1165 Ga0207693_10003938
1166 Ga0207693_10004992
1167 Ga0207693_10005699
1168 Ga0207693_10044528
1169 Ga0207663_10022475
1170 Ga0207663_10074322
1171 Ga0207663_10406697
1172 Ga0207663_10461684
1173 Ga0207663_10988548
1174 Ga0207660_10055524
1175 Ga0207660_10068043
1176 Ga0207662_10355510
1177 Ga0207657_10000246
1178 Ga0207657_10000292
1179 Ga0207657_10001266
1180 Ga0207649_10000242
1181 Ga0207649_10035420
1182 Ga0207652_10137235
1183 Ga0207652_10265697
1184 Ga0207646_10125198
1185 Ga0207681_10075318
1186 Ga0207694_10002864
1187 Ga0207694_10005754
1188 Ga0207694_10014163
1189 Ga0207694_10045721
1190 Ga0207694_10355243
1191 Ga0207694_10555289
1192 Ga0207650_10000090
1193 Ga0207650_11082910
1194 Ga0207659_10002035
1195 Ga0207687_10002307
1196 Ga0207687_10013901
1197 Ga0207687_10329020
1198 Ga0207700_10000685
1199 Ga0207700_10004609
1200 Ga0207700_10090161
1201 Ga0207700_10118884
1202 Ga0207700_10330357
1203 Ga0207700_11250885
1204 Ga0207700_11349304
1205 Ga0207664_10148252
1206 Ga0207664_10172385
1207 Ga0207664_10347576
1208 Ga0207664_10409035
1209 Ga0207664_10748508
1210 Ga0207644_10002582
1211 Ga0207690_10003087
1212 Ga0207690_10022450
1213 Ga0207690_10169754
1214 Ga0207690_11575827
1215 Ga0207706_10000139
1216 Ga0207706_10001055
1217 Ga0207706_10084476
1218 Ga0207686_10055788
1219 Ga0207709_10371488
1220 Ga0207670_10001693
1221 Ga0207670_10593248
1222 Ga0207669_11121922
1223 Ga0207704_10020900
1224 Ga0207704_10027609
1225 Ga0207704_10291971
1226 Ga0207665_10015670
1227 Ga0207665_10074253
1228 Ga0207665_10082116
1229 Ga0207665_10091681
1230 Ga0207665_10098521
1231 Ga0207665_10099049
1232 Ga0207665_10112571
1233 Ga0207665_10498451
1234 Ga0207665_10901943
1235 Ga0207691_10001343
1236 Ga0207711_10002838
1237 Ga0207711_10018665
1238 Ga0207711_10108962
1239 Ga0207711_11879466
1240 Ga0207689_10000304
1241 Ga0207689_10773812
1242 Ga0207661_10000583
1243 Ga0207661_10019113
1244 Ga0207661_10070730
1245 Ga0207679_10000184
1246 Ga0207679_10091753
1247 Ga0207679_10202751
1248 Ga0207667_10000170
1249 Ga0207667_10004029
1250 Ga0207667_10007225
1251 Ga0207667_10128304
1252 Ga0207667_10170718
1253 Ga0207667_10909583
1254 Ga0207651_10002456
1255 Ga0207651_10223679
1256 Ga0207712_10013954
1257 Ga0207712_10079479
1258 Ga0207668_10052744
1259 Ga0207668_10074687
1260 Ga0207668_10818059
1261 Ga0207640_10022601
1262 Ga0207640_10049454
1263 Ga0207640_10067491
1264 Ga0207640_10115583
1265 Ga0207658_10001983
1266 Ga0207658_11442689
1267 Ga0207677_10007606
1268 Ga0207677_10011702
1269 Ga0207677_10076939
1270 Ga0207677_10081360
1271 Ga0207677_10328926
1272 Ga0207703_10005260
1273 Ga0207703_10087059
1274 Ga0207703_10095986
1275 Ga0207703_10115619
1276 Ga0207639_10002287
1277 Ga0207639_10016884
1278 Ga0207639_10056072
1279 Ga0207639_10421191
1280 Ga0207678_10000204
1281 Ga0207678_10001833
1282 Ga0207702_10001597
1283 Ga0207702_10005883
1284 Ga0207702_10048664
1285 Ga0207702_10202697
1286 Ga0207702_10464806
1287 Ga0207702_10578668
1288 Ga0207702_11808931
1289 Ga0207702_11990640
1290 Ga0207641_10000894
1291 Ga0207641_10009428
1292 Ga0207641_10314118
1293 Ga0207641_10382005
1294 Ga0207648_10000757
1295 Ga0207648_10003612
1296 Ga0207648_10181375
1297 Ga0207676_10000113
1298 Ga0207676_10021492
1299 Ga0207674_10000076
1300 Ga0207674_10009505
1301 Ga0207674_10012344
1302 Ga0207674_10510987
1303 Ga0207675_100008819
1304 Ga0207675_100209346
1305 Ga0207683_10001129
1306 Ga0207683_10139318
1307 Ga0207698_10034814
1308 Ga0207698_10073362
1309 Ga0207698_10080537
1310 Ga0207698_10366752
1311 Ga0207698_10376022
1312 Ga0265354_1003475
1313 Ga0268266_10005373
1314 Ga0268266_10061763
1315 Ga0268266_10278856
1316 Ga0268265_10002144
1317 Ga0268264_10017158
1318 Ga0268264_10103205
1319 Ga0268264_10507744
1320 Ga0265762_1000676
1321 Ga0265762_1062789
1322 Ga0265770_1008320
1323 Ga0265770_1117410
1324 Ga0265760_10000206
1325 Ga0265760_10003560
1326 Ga0265760_10033288
1327 Ga0265760_10058278
1328 Ga0265313_10038348
1329 Ga0265342_10524984
1330 Ga0373940_0186662
1331 Ga0373940_0323771
1332 Ga0373952_0068054
1333 Ga0373923_0348710
1334 Ga0373923_0612287
1335 Ga0373932_0187903
1336 Ga0373936_0031150
1337 Ga0373945_0015579
1338 Ga0373956_0068571
1339 Ga0373956_0629148
1340 Ga0373946_0461935
1341 Ga0373946_0704577
1342 Ga0373955_0551014
1343 Ga0373961_0273698
1344 Ga0373931_0068842
1345 Ga0373931_0164848
1346 Ga0373931_0179118
1347 Ga0373935_0342165
1348 Ga0373927_0443442
1349 Ga0373933_0111032
1350 Ga0373933_0692894
1351 Ga0373947_0064565
1352 Ga0373947_0383275
1353 Ga0373937_0006928
1354 Ga0373937_0785266
1355 Ga0373937_1618714
1356 Ga0373925_0087337
1357 Ga0373925_0493020
1358 Ga0436363_0942494
1359 Ga0451839_0698791
1360 Ga0451576_1282436
1361 Ga0495592_0146182
1362 Ga0495651_0448419
1363 Ga0495653_0178202
1364 Ga0495580_0702637
1365 Ga0495662_0340690
1366 Ga0495662_0674788
1367 Ga0495664_0017250
1368 Ga0495664_0131284
1369 Ga0495608_0037373
1370 Ga0495618_0203085
1371 Ga0495628_0757193
1372 Ga0495630_0084986
1373 Ga0495630_0121352
1374 Ga0495642_0275056
1375 Ga0495652_0517785
1376 Ga0495640_0361501
1377 Ga0495640_0411852
1378 Ga0495587_0067745
1379 Ga0495645_0005114
1380 Ga0495645_0296977
1381 Ga0495667_0016821
1382 Ga0495667_0330784
1383 Ga0495635_0139099
1384 Ga0495635_0512669
1385 Ga0495657_0057793
1386 Ga0495599_0023481
1387 Ga0495623_0121806
1388 Ga0495623_0535569
1389 Ga0495646_0029962
1390 Ga0495669_0270201
1391 Ga0495669_0463321
1392 Ga0495589_0496529
1393 Ga0495600_0224293
1394 Ga0495604_0047356
1395 Ga0495604_0797291
1396 Ga0495674_0009662
1397 Ga0495674_0628774
1398 Ga0495680_0349915
1399 Ga0495684_0051903
1400 Ga0495684_0320770
1401 Ga0495602_0000360
1402 Ga0495602_0188241
1403 Ga0495602_0427794
1404 Ga0496100_0031661
1405 Ga0496100_0744742
1406 Ga0496101_0003461
1407 Ga0496101_0069100
1408 Ga0496101_0131212
1409 Ga0496101_0403020
1410 Ga0496101_0766498
1411 Ga0496102_0000537
1412 Ga0496102_0034176
1413 Ga0496102_0042175
1414 Ga0496102_0084755
1415 Ga0496103_0029061
1416 Ga0496103_0087374
1417 Ga0496103_0908958
1418 Ga0496104_0043291
1419 Ga0496104_0043663
1420 Ga0496104_0097111
1421 Ga0496104_0193678
1422 Ga0496104_0622441
1423 Ga0496104_0870699
1424 Ga0496105_0223019
1425 Ga0496105_0396745
1426 Ga0496105_0855422
1427 Ga0496106_0060516
1428 Ga0496106_0137926
1429 Ga0496106_0167565
1430 Ga0496106_0844584
1431 Ga0496107_0047707
1432 Ga0496107_0156443
1433 Ga0496107_0581475
1434 Ga0496107_0790807
1435 Ga0496108_0002118
1436 Ga0496109_0000008
1437 Ga0496109_1163704
1438 Ga0496109_1361679
1439 Ga0496110_0008075
1440 Ga0496110_0110860
1441 Ga0496111_0005563
1442 Ga0496112_0000334
1443 Ga0496112_0001276
1444 Ga0496112_0044733
1445 Ga0496112_0072790
1446 Ga0496112_0207500
1447 Ga0496112_0277531
1448 Ga0496112_0409378
1449 Ga0496113_0006066
1450 Ga0496113_0111874
1451 Ga0496113_0151138
1452 Ga0496113_0267616
1453 Ga0496114_0041204
1454 Ga0496115_0016349
1455 Ga0496115_0446328
1456 Ga0496115_0629328
1457 Ga0501047_0894319
1458 Ga0501073_0258869
1459 Ga0501044_0158399
1460 nmdc:mga08y16_1200968_c1
1461 nmdc:mga0n895_34675_c1
1462 nmdc:mga0n895_634_c1
1463 nmdc:mga0rr50_711970_c1
1464 nmdc:mga08x19_1121820_c1
1465 nmdc:mga08x19_12628_c1
1466 nmdc:mga08x19_168254_c1
1467 nmdc:mga0a205_117991_c1
1468 nmdc:mga0a205_493545_c1
1469 nmdc:mga0a205_905760_c1
1470 Ga0495601_0060993
1471 Ga0495601_0161914
1472 Ga0495612_0005112
1473 Ga0495612_0521841
1474 Ga0495595_0072005
1475 Ga0495619_0358892
1476 Ga0587077_191670

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

36

126

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9755 33 109
1uso-assembly1.cif.gz_A dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9459 33 107
2ebb-assembly1.cif.gz_A-2 crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 0.9446 18 110
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9387 33 109
3jst-assembly2.cif.gz_B crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis 0.9314 18 107
ID Description Score Start End Superfamily
1usoB00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9455 33 107 3.30.1360.20
2ebbA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9446 18 110 3.30.1360.20
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9413 16 108 3.30.1360.20
af_Q6MX13_31_126_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9356 18 110 3.30.1360.20
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9222 16 108 3.30.1360.20
ID Description Score Start End GO Terms
AF-A0A554JES3-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9959 23 108 GO:0006729
GO:0008124
AF-A0A2U3L9A9-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9944 19 109 GO:0006729
GO:0008124
AF-A0A2V9LDX8-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9922 1 110 GO:0006729
GO:0008124
AF-A0A7C2TT88-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9921 26 106 GO:0006729
GO:0008124
AF-A0A1E3XEU2-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9887 3 106 GO:0006729
GO:0008124

Map